10-Nitrolinoleic acid is a potent peroxisome proliferator-activated receptor γ (PPARγ) agonist. 10-Nitrolinoleic acid competes with [3H]Rosiglitazone for binding to PPAR-γ, with an IC50 of 0.22 μM[1].
N-Methyl-DL-aspartic acid is a glutamate analogue and acts as a potent neuronal excitant. N-Methyl-DL-aspartic acid is a NMDA receptor agonist and can be used for neurological diseases research[1][2].
AHK is a bioactive peptide with antioxidant effect and has been reported used as a cosmetic ingredient[1].
Procarbazine is an orally active alkylating agent, with anticancer activity. Procarbazine can be used in Hodgkin's disease research[1][2].
YF-2 is a highly selective, blood-brain-barrier permeable histone acetyltransferase activator, acetylates H3 in the hippocampus, with EC50s of 2.75 μM, 29.04 μM and 49.31 μM for CBP, PCAF, and GCN5, respectively, shows no effect on HDAC. Anti-cancer and anti-Alzheimer's disease[1].
Metallo-β-lactamase-IN-3 (compound 35) is a potent metallo-β-lactamases (MBL) inhibitor. Metallo-β-lactamase-IN-3 shows high activity against VIM-1 and NDM-1, with IC50 of 0.6 and 1.0 μM, respectively. Metallo-β-lactamase-IN-3 does not show inhibition of IMP-7[1].
[Gly9-OH]-Atosiban is the analogue of Atosiban (HY-17572).
Ethyl β-D-glucopyranoside (compound 10) is a kind of phenolic compound. Ethyl β-D-glucopyranoside can be isolated from ethanolic extract of Scabiosa stellata LS.
TEAD-IN-2 is a novel, orally active inhibitor of transcriptional enhancer associate domain (TEAD) and modulates TEAD by ubiquitination and/or degradation by compounds. TEAD-IN-2 can be used for the research of a variety of diseases, disorders or conditions associated with TEAD[1].
Tedizolid phosphate is a novel oxazolidinone with activity against Gram-positive pathogens.
BODIPY FL C12 is a green fluorescent dye, fluorescent fatty acid dye. BODIPY FL C12 reacts with primary amines on biomolecules and can be used as a protein marker. BODIPY FL C12 can be used as a fluorescent probe that monitor fatty acyls[1][2].
6,8-Diprenylgenistein is an isoflavone compound isolated from Cudrania tricuspidata. 6,8-Diprenylgenistein has antimicrobial and anti-obesity activity. 6,8-Diprenylgenistein inhibits the proliferation, migration and tubular formation of HLMEC induced by recombinant human vascular endothelial growth factor-A. 6,8-Diprenylgenistein can be used to study new therapeutic drugs for the prevention and treatment of oral cancer metastasis [1].
Isoglobotetraose (Globoisotetraose) is the oligosaccharide moiety of human glycosphingolipids. Synthesis process: globotetraose (GalNAcβ1→3Galα1→4Galβ1→4Glc) and isoglobotetraose (GalNAcβ1→3Galα1→3Galβ1→4Glc)[1].
MB-7133 is a DNA synthesis inhibitor.
2-Methylquinazolin-4-ol is a potent competitive poly(ADP-ribose) synthetase inhibitor, with a Ki of 1.1 μM. 2-Methylquinazolin-4-ol mammalian aspartate transcarbamylase (ATCase) inhibitor, with 0.20 mM[1][2].
Pentaerythrityl tetrastearate is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
Gemcitabine-13C,15N2 (hydrochloride) is the 13C and 15N labeled Gemcitabine hydrochloride[1]. Gemcitabine Hydrochloride (LY 188011 Hydrochloride) is a pyrimidine nucleoside analog antimetabolite and an antineoplastic agent. Gemcitabine Hydrochloride inhibits DNA synthesis and repair, resulting in autophagyand apoptosis[2][3].
Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.
Carbidopa is an inhibitor of DOPA decarboxylase, which is used in parkinson disease.Target: DOPA decarboxylaseCarbidopa (CD), a competitive inhibitor of aromatic l-amino acid decarboxylase that does not cross the blood-brain barrier, is routinely administered with levodopa (LD) to patients with Parkinson disease (PD) to reduce the peripheral decarboxylation of LD to dopamine [1]. CD premedication improves 11C-5-HTP PET image quality and facilitates detection of NET lesions. Because of the similarity of metabolic pathways, this method could probably be applied to improve PET imaging using other tracers like 18F-DOPA and 11C-DOPA [2]. Carbidopa (100 microM) decreased growth of (but did not kill) SK-N-SH neuroblastoma and A204 rhabdomyosarcoma cells and did not affect proliferation of DU 145 prostate, MCF7 breast, or NCI-H460 large cell lung carcinoma lines. sublethal doses of carbidopa produced additive cytotoxic effects in carcinoid cells in combination with etoposide and cytotoxic synergy in SCLC cells when coincubated with topotecan [3].
GS-493 is a novel potent, selective SHP2 inhibitor with IC50 of 71±15 nM in enzyme assay; displays 29- and 45-fold selectivity against related SHP1 and PTP1B; blocks HGF-stimulated epithelial-mesenchymal transition of human pancreatic adenocarcinoma (HPAF) cells, and inhibits cell colony formation in the NSCLC cell line LXFA 526L in soft agar; inhibits tumor growth in murine xenograft model.
Pseudoprotodioscin, a furostanoside, inhibits SREBP1/2 and microRNA 33a/b levels and reduces the gene expression regarding the synthesis of cholesterol and triglycerides[1].
MOPSO sodium can be used for the preparation of buffer solution. MOPSO sodium is used as a biochemical reagent[1].
Flavin Adenin Dinucleotide is a redox cofactor, more specifically a prosthetic group of a protein, involved in several important enzymatic reactions in metabolism.
TFC-007, a selective hematopoietic prostaglandin D synthase (H-PGDS) inhibitor, show high inhibitory activity against H-PGDS enzyme (IC50 value of 83 nM). TFC-007 can be used for composing H-PGDS degradation inducer PROTAC(H-PGDS)-1 (TFC-007 binds to H-PGDS, and Pomalidomide binds to cereblon)[1].
8-Bromo-2'-deoxyadenosine is a purine nucleoside analog. Purine nucleoside analogs have broad antitumor activity targeting indolent lymphoid malignancies. Anticancer mechanisms in this process rely on inhibition of DNA synthesis, induction of apoptosis, etc[1].
CYP3A4 enzyme-IN-1 (compound 59) is a potent antibacterial agent, with a MIC of 1 μg/mL for MRSA. CYP3A4 enzyme-IN-1 exhibits low to moderate inhibitory effects on CYP1A2, CYP2E1, CYP2D6, and CYP3A4 enzymes[1].
NADP sodium hydrate, a β-Nicotinamide adenine dinucleotide phosphate sodium salt, is a redox cofactor. NADP sodium hydrate is a key cofactor for electron transfer in the metabolism, being alternately oxidized (NADP+) and reduced (NADPH)[1][2].
2-Amino-6-chloropurine -9-beta-D-(2’-deoxy-3’,5’-di-O-benzoyl-2’-fluoro)arabinoriboside is a purine nucleoside analog. Purine nucleoside analogs have broad antitumor activity targeting indolent lymphoid malignancies. Anticancer mechanisms in this process rely on inhibition of DNA synthesis, induction of apoptosis, etc[1].
Maritoclax (Marinopyrrole A) is a novel and specific Mcl-1 inhibitor with an IC50 value of 10.1 μM, and shows >8 fold selectivity than BCL-xl (IC50 > 80 μM).
Bis-PEG4-acid is a PEG PROTAC linker.