Chemsrc provides Research Areas's classification. They are divided into Others, Cancer, Cardiovascular Disease, Endocrinology, Infection, Inflammation/Immunology, Metabolic Disease, Neurological Disease according to their Biological activity.


Anti-infection >
Arenavirus Bacterial CMV Enterovirus Filovirus Fungal HBV HCV HIV HSV Influenza Virus Parasite Reverse Transcriptase RSV SARS-CoV
Antibody-drug Conjugate >
ADC Cytotoxin ADC Linker Drug-Linker Conjugates for ADC PROTAC-linker Conjugate for PAC
Apoptosis >
Apoptosis Bcl-2 Family c-Myc Caspase DAPK Ferroptosis IAP MDM-2/p53 PKD RIP kinase Survivin Thymidylate Synthase TNF Receptor
Autophagy >
Autophagy LRRK2 ULK Mitophagy
Cell Cycle/DNA Damage >
Antifolate APC ATM/ATR Aurora Kinase Casein Kinase CDK Checkpoint Kinase (Chk) CRISPR/Cas9 Deubiquitinase DNA Alkylator/Crosslinker DNA-PK DNA/RNA Synthesis Eukaryotic Initiation Factor (eIF) G-quadruplex Haspin Kinase HDAC HSP IRE1 Kinesin LIM Kinase (LIMK) Microtubule/Tubulin Mps1 Nucleoside Antimetabolite/Analog p97 PAK PARP PERK Polo-like Kinase (PLK) PPAR RAD51 ROCK Sirtuin SRPK Telomerase TOPK Topoisomerase Wee1
Cytoskeleton >
Arp2/3 Complex Dynamin Gap Junction Protein Integrin Kinesin Microtubule/Tubulin Mps1 Myosin PAK
Epigenetics >
AMPK Aurora Kinase DNA Methyltransferase Epigenetic Reader Domain HDAC Histone Acetyltransferase Histone Demethylase Histone Methyltransferase JAK MicroRNA PARP PKC Sirtuin Protein Arginine Deiminase
GPCR/G Protein >
5-HT Receptor Adenosine Receptor Adenylate Cyclase Adiponectin Receptor Adrenergic Receptor Angiotensin Receptor Bombesin Receptor Bradykinin Receptor Cannabinoid Receptor CaSR CCR CGRP Receptor Cholecystokinin Receptor CRFR CXCR Dopamine Receptor EBI2/GPR183 Endothelin Receptor GHSR Glucagon Receptor Glucocorticoid Receptor GNRH Receptor GPCR19 GPR109A GPR119 GPR120 GPR139 GPR40 GPR55 GPR84 Guanylate Cyclase Histamine Receptor Imidazoline Receptor Leukotriene Receptor LPL Receptor mAChR MCHR1 (GPR24) Melatonin Receptor mGluR Motilin Receptor Neurokinin Receptor Neuropeptide Y Receptor Neurotensin Receptor Opioid Receptor Orexin Receptor (OX Receptor) Oxytocin Receptor P2Y Receptor Prostaglandin Receptor Protease-Activated Receptor (PAR) Ras RGS Protein Sigma Receptor Somatostatin Receptor TSH Receptor Urotensin Receptor Vasopressin Receptor Melanocortin Receptor
Immunology/Inflammation >
Aryl Hydrocarbon Receptor CCR Complement System COX CXCR FLAP Histamine Receptor IFNAR Interleukin Related IRAK MyD88 NO Synthase NOD-like Receptor (NLR) PD-1/PD-L1 PGE synthase Salt-inducible Kinase (SIK) SPHK STING Thrombopoietin Receptor Toll-like Receptor (TLR) Arginase
JAK/STAT Signaling >
EGFR JAK Pim STAT
MAPK/ERK Pathway >
ERK JNK KLF MAP3K MAP4K MAPKAPK2 (MK2) MEK Mixed Lineage Kinase MNK p38 MAPK Raf Ribosomal S6 Kinase (RSK)
Membrane Transporter/Ion Channel >
ATP Synthase BCRP Calcium Channel CFTR Chloride Channel CRAC Channel CRM1 EAAT2 GABA Receptor GlyT HCN Channel iGluR Monoamine Transporter Monocarboxylate Transporter Na+/Ca2+ Exchanger Na+/HCO3- Cotransporter Na+/K+ ATPase nAChR NKCC P-glycoprotein P2X Receptor Potassium Channel Proton Pump SGLT Sodium Channel TRP Channel URAT1
Metabolic Enzyme/Protease >
15-PGDH 5 alpha Reductase 5-Lipoxygenase Acetyl-CoA Carboxylase Acyltransferase Adenosine Deaminase Adenosine Kinase Aldehyde Dehydrogenase (ALDH) Aldose Reductase Aminopeptidase Angiotensin-converting Enzyme (ACE) ATGL ATP Citrate Lyase Carbonic Anhydrase Carboxypeptidase Cathepsin CETP COMT Cytochrome P450 Dipeptidyl Peptidase Dopamine β-hydroxylase E1/E2/E3 Enzyme Elastase Enolase FAAH FABP Factor Xa Farnesyl Transferase Fatty Acid Synthase (FAS) FXR Glucokinase GSNOR Gutathione S-transferase HCV Protease Hexokinase HIF/HIF Prolyl-Hydroxylase HIV Integrase HIV Protease HMG-CoA Reductase (HMGCR) HSP Indoleamine 2,3-Dioxygenase (IDO) Isocitrate Dehydrogenase (IDH) Lactate Dehydrogenase LXR MAGL Mineralocorticoid Receptor Mitochondrial Metabolism MMP Nampt NEDD8-activating Enzyme Neprilysin PAI-1 PDHK PGC-1α Phosphatase Phosphodiesterase (PDE) Phospholipase Procollagen C Proteinase Proteasome Pyruvate Kinase RAR/RXR Renin ROR Ser/Thr Protease SGK Stearoyl-CoA Desaturase (SCD) Thrombin Tryptophan Hydroxylase Tyrosinase Xanthine Oxidase
Neuronal Signaling >
5-HT Receptor AChE Adenosine Kinase Amyloid-β Beta-secretase CaMK CGRP Receptor COMT Dopamine Receptor Dopamine Transporter FAAH GABA Receptor GlyT iGluR Imidazoline Receptor mAChR Melatonin Receptor Monoamine Oxidase nAChR Neurokinin Receptor Opioid Receptor Serotonin Transporter γ-secretase
NF-κB >
NF-κB IKK Keap1-Nrf2 MALT1
PI3K/Akt/mTOR >
Akt AMPK ATM/ATR DNA-PK GSK-3 MELK mTOR PDK-1 PI3K PI4K PIKfyve PTEN
PROTAC >
PROTAC E3 Ligase Ligand-Linker Conjugate Ligand for E3 Ligase PROTAC Linker PROTAC-linker Conjugate for PAC
Protein Tyrosine Kinase/RTK >
Ack1 ALK Bcr-Abl BMX Kinase Btk c-Fms c-Kit c-Met/HGFR Discoidin Domain Receptor DYRK EGFR Ephrin Receptor FAK FGFR FLT3 IGF-1R Insulin Receptor IRAK Itk PDGFR PKA Pyk2 ROS Src Syk TAM Receptor Trk Receptor VEGFR
Stem Cell/Wnt >
Casein Kinase ERK Gli GSK-3 Hedgehog Hippo (MST) JAK Notch Oct3/4 PKA Porcupine ROCK sFRP-1 Smo STAT TGF-beta/Smad Wnt YAP β-catenin γ-secretase
TGF-beta/Smad >
TGF-beta/Smad PKC ROCK TGF-β Receptor
Vitamin D Related >
VD/VDR
Others >
Androgen Receptor Aromatase Estrogen Receptor/ERR Progesterone Receptor Thyroid Hormone Receptor Others

10-Nitrolinoleic acid

10-Nitrolinoleic acid is a potent peroxisome proliferator-activated receptor γ (PPARγ) agonist. 10-Nitrolinoleic acid competes with [3H]Rosiglitazone for binding to PPAR-γ, with an IC50 of 0.22 μM[1].

  • CAS Number: 774603-04-2
  • MF: C18H31NO4
  • MW: 325.443
  • Catalog: PPAR
  • Density: 1.0±0.1 g/cm3
  • Boiling Point: 452.2±33.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 173.9±13.8 °C

UNII:EU52DFC4WJ

N-Methyl-DL-aspartic acid is a glutamate analogue and acts as a potent neuronal excitant. N-Methyl-DL-aspartic acid is a NMDA receptor agonist and can be used for neurological diseases research[1][2].

  • CAS Number: 17833-53-3
  • MF: C5H9NO4
  • MW: 147.129
  • Catalog: iGluR
  • Density: 1.3±0.1 g/cm3
  • Boiling Point: 258.2±30.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 110.0±24.6 °C

H-Ala-His-Lys-OH acetate salt

AHK is a bioactive peptide with antioxidant effect and has been reported used as a cosmetic ingredient[1].

  • CAS Number: 126828-32-8
  • MF: C15H26N6O4
  • MW: 354.40500
  • Catalog: Inflammation/Immunology
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Procarbazine

Procarbazine is an orally active alkylating agent, with anticancer activity. Procarbazine can be used in Hodgkin's disease research[1][2].

  • CAS Number: 671-16-9
  • MF: C12H19N3O
  • MW: 221.299
  • Catalog: DNA Alkylator/Crosslinker
  • Density: 1.0±0.1 g/cm3
  • Boiling Point: 384.6±35.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 148.9±26.1 °C

YF-2

YF-2 is a highly selective, blood-brain-barrier permeable histone acetyltransferase activator, acetylates H3 in the hippocampus, with EC50s of 2.75 μM, 29.04 μM and 49.31 μM for CBP, PCAF, and GCN5, respectively, shows no effect on HDAC. Anti-cancer and anti-Alzheimer's disease[1].

  • CAS Number: 1311423-89-8
  • MF: C20H22ClF3N2O3
  • MW: 430.84800
  • Catalog: Histone Acetyltransferase
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Metallo-β-lactamase-IN-3

Metallo-β-lactamase-IN-3 (compound 35) is a potent metallo-β-lactamases (MBL) inhibitor. Metallo-β-lactamase-IN-3 shows high activity against VIM-1 and NDM-1, with IC50 of 0.6 and 1.0 μM, respectively. Metallo-β-lactamase-IN-3 does not show inhibition of IMP-7[1].

  • CAS Number: 128294-71-3
  • MF: C10H11NO3S
  • MW: 225.26
  • Catalog: Bacterial
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

[Gly9-OH]-Atosiban

[Gly9-OH]-Atosiban is the analogue of Atosiban (HY-17572).

  • CAS Number: 168102-69-0
  • MF: C43H66N10O13S2
  • MW: 995.17
  • Catalog: Others
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

UNII:AQ51A12T8K

Ethyl β-D-glucopyranoside (compound 10) is a kind of phenolic compound. Ethyl β-D-glucopyranoside can be isolated from ethanolic extract of Scabiosa stellata LS.

  • CAS Number: 3198-49-0
  • MF: C8H16O6
  • MW: 208.209
  • Catalog: Others
  • Density: 1.4±0.1 g/cm3
  • Boiling Point: 395.1±42.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 192.7±27.9 °C

TEAD-IN-2

TEAD-IN-2 is a novel, orally active inhibitor of transcriptional enhancer associate domain (TEAD) and modulates TEAD by ubiquitination and/or degradation by compounds. TEAD-IN-2 can be used for the research of a variety of diseases, disorders or conditions associated with TEAD[1].

  • CAS Number: 2563849-97-6
  • MF: C16H18BrF3N2O
  • MW: 391.23
  • Catalog: YAP
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Tedizolid Phosphate

Tedizolid phosphate is a novel oxazolidinone with activity against Gram-positive pathogens.

  • CAS Number: 856867-55-5
  • MF: C17H16FN6O6P
  • MW: 450.318
  • Catalog: Bacterial
  • Density: 1.8±0.1 g/cm3
  • Boiling Point: 725.6±70.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 392.6±35.7 °C

BODIPY FL C12

BODIPY FL C12 is a green fluorescent dye, fluorescent fatty acid dye. BODIPY FL C12 reacts with primary amines on biomolecules and can be used as a protein marker. BODIPY FL C12 can be used as a fluorescent probe that monitor fatty acyls[1][2].

  • CAS Number: 158757-79-0
  • MF: C23H33BF2N2O2
  • MW: 418.33
  • Catalog: Others
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

6,8-diprenylgenistein

6,8-Diprenylgenistein is an isoflavone compound isolated from Cudrania tricuspidata. 6,8-Diprenylgenistein has antimicrobial and anti-obesity activity. 6,8-Diprenylgenistein inhibits the proliferation, migration and tubular formation of HLMEC induced by recombinant human vascular endothelial growth factor-A. 6,8-Diprenylgenistein can be used to study new therapeutic drugs for the prevention and treatment of oral cancer metastasis [1].

  • CAS Number: 51225-28-6
  • MF: C25H26O5
  • MW: 406.47
  • Catalog: Cancer
  • Density: 1.2±0.1 g/cm3
  • Boiling Point: 627.4±55.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 214.6±25.0 °C

Isoglobotetraose

Isoglobotetraose (Globoisotetraose) is the oligosaccharide moiety of human glycosphingolipids. Synthesis process: globotetraose (GalNAcβ1→3Galα1→4Galβ1→4Glc) and isoglobotetraose (GalNAcβ1→3Galα1→3Galβ1→4Glc)[1].

  • CAS Number: 75645-26-0
  • MF: C26H45NO21
  • MW: 707.63
  • Catalog: Others
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

MB-7133

MB-7133 is a DNA synthesis inhibitor.

  • CAS Number: 685111-92-6
  • MF: C17H21N4O8P
  • MW: 440.34400
  • Catalog: DNA/RNA Synthesis
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

2-Methylquinazolin-4-ol

2-Methylquinazolin-4-ol is a potent competitive poly(ADP-ribose) synthetase inhibitor, with a Ki of 1.1 μM. 2-Methylquinazolin-4-ol mammalian aspartate transcarbamylase (ATCase) inhibitor, with 0.20 mM[1][2].

  • CAS Number: 1769-24-0
  • MF: C9H8N2O
  • MW: 160.17300
  • Catalog: PARP
  • Density: 1.26 g/cm3
  • Boiling Point: 305.4ºC at 760 mmHg
  • Melting Point: 231-233ºC(lit.)
  • Flash Point: 138.5ºC

Pentaerythritol Tetrastearate (so called)

Pentaerythrityl tetrastearate is a biochemical reagent that can be used as a biological material or organic compound for life science related research.

  • CAS Number: 115-83-3
  • MF: C77H148O8
  • MW: 1201.994
  • Catalog: Others
  • Density: 0.9±0.1 g/cm3
  • Boiling Point: 998.5±60.0 °C at 760 mmHg
  • Melting Point: 60-66 °C
  • Flash Point: 342.4±32.9 °C

Gemcitabine-13C,15N2 hydrochloride

Gemcitabine-13C,15N2 (hydrochloride) is the 13C and 15N labeled Gemcitabine hydrochloride[1]. Gemcitabine Hydrochloride (LY 188011 Hydrochloride) is a pyrimidine nucleoside analog antimetabolite and an antineoplastic agent. Gemcitabine Hydrochloride inhibits DNA synthesis and repair, resulting in autophagyand apoptosis[2][3].

  • CAS Number: 2757566-59-7
  • MF: C813CH12ClF2N15N2O4
  • MW: 302.64
  • Catalog: Apoptosis
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Dulaglutide

Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.

  • CAS Number: 923950-08-7
  • MF: C149H221N37O49
  • MW: 3314.62
  • Catalog: Peptides
  • Density: 1.4±0.1 g/cm3
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Carbidopa

Carbidopa is an inhibitor of DOPA decarboxylase, which is used in parkinson disease.Target: DOPA decarboxylaseCarbidopa (CD), a competitive inhibitor of aromatic l-amino acid decarboxylase that does not cross the blood-brain barrier, is routinely administered with levodopa (LD) to patients with Parkinson disease (PD) to reduce the peripheral decarboxylation of LD to dopamine [1]. CD premedication improves 11C-5-HTP PET image quality and facilitates detection of NET lesions. Because of the similarity of metabolic pathways, this method could probably be applied to improve PET imaging using other tracers like 18F-DOPA and 11C-DOPA [2]. Carbidopa (100 microM) decreased growth of (but did not kill) SK-N-SH neuroblastoma and A204 rhabdomyosarcoma cells and did not affect proliferation of DU 145 prostate, MCF7 breast, or NCI-H460 large cell lung carcinoma lines. sublethal doses of carbidopa produced additive cytotoxic effects in carcinoid cells in combination with etoposide and cytotoxic synergy in SCLC cells when coincubated with topotecan [3].

  • CAS Number: 28860-95-9
  • MF: C10H14N2O4
  • MW: 226.23
  • Catalog: Neurological Disease
  • Density: 1.4±0.1 g/cm3
  • Boiling Point: 528.7±50.0 °C at 760 mmHg
  • Melting Point: 206 - 208ºC
  • Flash Point: 273.5±30.1 °C

GS-493

GS-493 is a novel potent, selective SHP2 inhibitor with IC50 of 71±15 nM in enzyme assay; displays 29- and 45-fold selectivity against related SHP1 and PTP1B; blocks HGF-stimulated epithelial-mesenchymal transition of human pancreatic adenocarcinoma (HPAF) cells, and inhibits cell colony formation in the NSCLC cell line LXFA 526L in soft agar; inhibits tumor growth in murine xenograft model.

  • CAS Number: 1710337-31-7
  • MF: C21H14N6O8S
  • MW: 510.437
  • Catalog: Phosphatase
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Pseudoprotodioscin

Pseudoprotodioscin, a furostanoside, inhibits SREBP1/2 and microRNA 33a/b levels and reduces the gene expression regarding the synthesis of cholesterol and triglycerides[1].

  • CAS Number: 102115-79-7
  • MF: C51H82O21
  • MW: 1031.184
  • Catalog: MicroRNA
  • Density: 1.45 g/cm3
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

MOPSO sodium salt

MOPSO sodium can be used for the preparation of buffer solution. MOPSO sodium is used as a biochemical reagent[1].

  • CAS Number: 79803-73-9
  • MF: C7H14NNaO5S
  • MW: 247.245
  • Catalog: Others
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

FAD

Flavin Adenin Dinucleotide is a redox cofactor, more specifically a prosthetic group of a protein, involved in several important enzymatic reactions in metabolism.

  • CAS Number: 146-14-5
  • MF: C27H33N9O15P2
  • MW: 785.550
  • Catalog: Others
  • Density: 2.1±0.1 g/cm3
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

TFC 007

TFC-007, a selective hematopoietic prostaglandin D synthase (H-PGDS) inhibitor, show high inhibitory activity against H-PGDS enzyme (IC50 value of 83 nM). TFC-007 can be used for composing H-PGDS degradation inducer PROTAC(H-PGDS)-1 (TFC-007 binds to H-PGDS, and Pomalidomide binds to cereblon)[1].

  • CAS Number: 927878-49-7
  • MF: C27H29N5O4
  • MW: 487.55
  • Catalog: PGE synthase
  • Density: 1.3±0.1 g/cm3
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

8-Bromo-2'-deoxyadenosine

8-Bromo-2'-deoxyadenosine is a purine nucleoside analog. Purine nucleoside analogs have broad antitumor activity targeting indolent lymphoid malignancies. Anticancer mechanisms in this process rely on inhibition of DNA synthesis, induction of apoptosis, etc[1].

  • CAS Number: 14985-44-5
  • MF: C10H12BrN5O3
  • MW: 330.14
  • Catalog: Nucleoside Antimetabolite/Analog
  • Density: 2.3g/cm3
  • Boiling Point: 671ºC at 760mmHg
  • Melting Point: N/A
  • Flash Point: 359.6ºC

CYP3A4 enzyme-IN-1

CYP3A4 enzyme-IN-1 (compound 59) is a potent antibacterial agent, with a MIC of 1 μg/mL for MRSA. CYP3A4 enzyme-IN-1 exhibits low to moderate inhibitory effects on CYP1A2, CYP2E1, CYP2D6, and CYP3A4 enzymes[1].

  • CAS Number: 2531281-25-9
  • MF: C41H58N8O7
  • MW: 774.95
  • Catalog: Bacterial
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Triphosphopyridine nucleotide sodium salt hydrate

NADP sodium hydrate, a β-Nicotinamide adenine dinucleotide phosphate sodium salt, is a redox cofactor. NADP sodium hydrate is a key cofactor for electron transfer in the metabolism, being alternately oxidized (NADP+) and reduced (NADPH)[1][2].

  • CAS Number: 698999-85-8
  • MF: C21H27N7NaO17P3
  • MW: 765.38700
  • Catalog: Others
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: 175-178ºC (dec.)(lit.)
  • Flash Point: N/A

2-Amino-6-chloropurine-9-beta-D-(2'-deoxy-3',5'-di-O-benzoyl-2'-fluoro)arabinoriboside

2-Amino-6-chloropurine -9-beta-D-(2’-deoxy-3’,5’-di-O-benzoyl-2’-fluoro)arabinoriboside is a purine nucleoside analog. Purine nucleoside analogs have broad antitumor activity targeting indolent lymphoid malignancies. Anticancer mechanisms in this process rely on inhibition of DNA synthesis, induction of apoptosis, etc[1].

  • CAS Number: 118373-61-8
  • MF: C24H19ClFN5O5
  • MW: 511.89
  • Catalog: Nucleoside Antimetabolite/Analog
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A

Marinopyrrole A

Maritoclax (Marinopyrrole A) is a novel and specific Mcl-1 inhibitor with an IC50 value of 10.1 μM, and shows >8 fold selectivity than BCL-xl (IC50 > 80 μM).

  • CAS Number: 1227962-62-0
  • MF: C22H12Cl4N2O4
  • MW: 510.154
  • Catalog: Bcl-2 Family
  • Density: 1.6±0.1 g/cm3
  • Boiling Point: 732.4±60.0 °C at 760 mmHg
  • Melting Point: N/A
  • Flash Point: 396.7±32.9 °C

Bis-PEG5-acid

Bis-PEG4-acid is a PEG PROTAC linker.

  • CAS Number: 31127-85-2
  • MF: C12H22O8
  • MW: 294.30
  • Catalog: PROTAC Linker
  • Density: N/A
  • Boiling Point: N/A
  • Melting Point: N/A
  • Flash Point: N/A