[Leu5]-Enkephalin, amide is a δ opioid receptor agonist.
BNP-45 (rat), a 45-amino acid brain natriurctic peptide isolated from rat heart, is a circulating hormone, with natriuretic andhypotensive activities.
Adrenocorticotropic Hormone (ACTH) (4-10), human is a melanocortin 4 (MC4R) receptor agonist.
C-Type Natriuretic Peptide (CNP) (1-22), human is the 1-22 fragment of C-Type Natriuretic Peptide. C-type natriuretic peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.
Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.
MPG, HIV related is 27-aa peptide, derived from both the nuclear localisation sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41 and is a potent delivery agent for the generalised delivery of nucleic acids and of oligonucleotides into cultured cells.
Sincalide is a rapid-acting, synthetic analog of cholecystokinin for intravenous use in postevacuation cholecystography. Sequence: Asp-{SO3H-Tyr}-Met-Gly-Trp-Met-Asp-Phe-NH2.
Asp-Asp-Asp-Asp-Asp is a peptide consists of 5 Asp.
Ac-DEVD-AFC is a fluorogenic substrate (λex=400 nm, λem=530 nm).