Gastric Inhibitory Polypeptide (human)
Gastric Inhibitory Polypeptide (human) structure
|
Common Name | Gastric Inhibitory Polypeptide (human) | ||
|---|---|---|---|---|
| CAS Number | 100040-31-1 | Molecular Weight | 4983.53 | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | C226H338N60O66S | Melting Point | N/A | |
| MSDS | USA | Flash Point | N/A | |
Use of Gastric Inhibitory Polypeptide (human)Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions. |
| Name | Gastric Inhibitory Polypeptide human |
|---|---|
| Synonym | More Synonyms |
| Description | Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions. |
|---|---|
| Related Catalog | |
| In Vitro | Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state,sup>[1]. |
| References |
| Molecular Formula | C226H338N60O66S |
|---|---|
| Molecular Weight | 4983.53 |
| Storage condition | -20°C |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| Hazard Codes | Xn |
| RIDADR | NONH for all modes of transport |
| WGK Germany | 3.0 |
|
Long-term persistence of hormonal adaptations to weight loss.
N. Engl. J. Med. 365 , 1597-1604, (2011) After weight loss, changes in the circulating levels of several peripheral hormones involved in the homeostatic regulation of body weight occur. Whether these changes are transient or persist over tim... |
|
|
Pleiotropic effects of GIP on islet function involve osteopontin.
Diabetes 60 , 2424-2433, (2011) The incretin hormone GIP (glucose-dependent insulinotropic polypeptide) promotes pancreatic β-cell function by potentiating insulin secretion and β-cell proliferation. Recently, a combined analysis of... |
|
|
Gastric inhibitory polypeptide and its receptor are expressed in the central nervous system and support neuronal survival.
Cent. Nerv. Syst. Agents Med. Chem. 11 , 210-222, (2011) The development of neuronal apoptosis depends on an intrinsic transcriptional program. By DNA microarray technology, we have previously implicated a number of genes in different paradigms of neuronal ... |
| MFCD00081634 |
| GIP, human |
| YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Gastric Inhibitory Peptide (GIP), human |