11063-17-5

11063-17-5 structure

Name: Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
Chemical Name: Gastric Inhibitory Polypeptide (porcine)
CAS Number: 11063-17-5
Molecular Formula: C₅H₁₀O₁₀P₂
Molecular Weight: 292.074
Catalog: Signaling Pathways Protein Tyrosine Kinase/RTK Insulin Receptor
Create Date: 2018-08-08 14:07:55
Modify Date: 2025-08-21 01:32:50
Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism[1].

Name	Gastric Inhibitory Polypeptide (porcine)
Synonyms	Butanedioic acid, 3-methyl-2,2-diphosphono- 3-Methyl-2,2-diphosphonosuccinic acid Porcine gastric inhibitory polypeptide Pig gastric inhibitory polypeptide Porcine gastric inhibitory peptide YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

Description	Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism[1].
Related Catalog	Research Areas >> Endocrinology Signaling Pathways >> Protein Tyrosine Kinase/RTK >> Insulin Receptor
References	[1]. G W Morrow, et al. The insulinotropic region of gastric inhibitory polypeptide; fragment analysis suggests the bioactive site lies between residues 19 and 30. Canadian Journal of Physiology and Pharmacology. January 1996. Volume 74.