Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
Modify Date: 2025-08-21 01:32:50
Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt structure
|
Common Name | Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt | ||
|---|---|---|---|---|
| CAS Number | 11063-17-5 | Molecular Weight | 292.074 | |
| Density | 2.1±0.1 g/cm3 | Boiling Point | 637.8±65.0 °C at 760 mmHg | |
| Molecular Formula | C5H10O10P2 | Melting Point | N/A | |
| MSDS | N/A | Flash Point | 339.6±34.3 °C | |
Use of Gastric Inhibitory Polypeptide (porcine) trifluoroacetate saltGastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism[1]. |
| Name | Gastric Inhibitory Polypeptide (porcine) |
|---|---|
| Synonym | More Synonyms |
| Description | Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism[1]. |
|---|---|
| Related Catalog | |
| References |
| Density | 2.1±0.1 g/cm3 |
|---|---|
| Boiling Point | 637.8±65.0 °C at 760 mmHg |
| Molecular Formula | C5H10O10P2 |
| Molecular Weight | 292.074 |
| Flash Point | 339.6±34.3 °C |
| Exact Mass | 291.974915 |
| LogP | -1.90 |
| Vapour Pressure | 0.0±4.1 mmHg at 25°C |
| Index of Refraction | 1.609 |
| Butanedioic acid, 3-methyl-2,2-diphosphono- |
| 3-Methyl-2,2-diphosphonosuccinic acid |
| Porcine gastric inhibitory polypeptide |
| Pig gastric inhibitory polypeptide |
| Porcine gastric inhibitory peptide |
| YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |