GRP (human)

Modify Date: 2025-08-23 10:48:55

GRP (human) Structure
GRP (human) structure
Common Name GRP (human)
CAS Number 93755-85-2 Molecular Weight 2859.377
Density 1.5±0.1 g/cm3 Boiling Point N/A
Molecular Formula C130H204N38O31S2 Melting Point N/A
MSDS Chinese USA Flash Point N/A

 Use of GRP (human)


Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.

 Names

Name Gastrin Releasing Peptide human
Synonym More Synonyms

 GRP (human) Biological Activity

Description Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.
Related Catalog
In Vitro Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release. However, GRP/bombesin-like immunoreactivity is widely distributed in mammalian brain, especially the hypothalamus, GI tract and in human fetal lung[1].
References

[1]. Dubovy SR, et al. Expression of hypothalamic neurohormones and their receptors in the human eye. Oncotarget. 2017 Jun 3.

 Chemical & Physical Properties

Density 1.5±0.1 g/cm3
Molecular Formula C130H204N38O31S2
Molecular Weight 2859.377
Exact Mass 2857.499512
LogP -1.40
Index of Refraction 1.672
InChIKey PUBCCFNQJQKCNC-UHFFFAOYSA-N
SMILES CSCCC(NC(=O)C(CC(C)C)NC(=O)C(Cc1c[nH]cn1)NC(=O)CNC(=O)C(NC(=O)C(C)NC(=O)C(Cc1c[nH]c2ccccc12)NC(=O)C(Cc1c[nH]cn1)NC(=O)C(CC(N)=O)NC(=O)CNC(=O)C(CCCNC(=N)N)NC(=O)C1CCCN1C(=O)C(Cc1ccc(O)cc1)NC(=O)C(CCSC)NC(=O)C(CCCCN)NC(=O)C(NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(NC(=O)CNC(=O)CNC(=O)CNC(=O)C(C)NC(=O)C1CCCN1C(=O)C(CC(C)C)NC(=O)C1CCCN1C(=O)C(N)C(C)C)C(C)O)C(C)C)C(C)O)C(C)C)C(N)=O

 Safety Information

Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR NONH for all modes of transport

 Articles49

More Articles
Straightforward method to quantify GSH, GSSG, GRP, and hydroxycinnamic acids in wines by UPLC-MRM-MS.

J. Agric. Food Chem. 63(1) , 142-9, (2015)

A novel, robust and fast ultrahigh performance liquid chromatography–multiple reaction monitoring mass spectrometry method has been developed for the simultaneous quantification of reduced glutathione...

Chloroacetic acid triggers apoptosis in neuronal cells via a reactive oxygen species-induced endoplasmic reticulum stress signaling pathway.

Chem. Biol. Interact. 225 , 1-12, (2015)

Chloroacetic acid (CA), a chlorinated analog of acetic acid and an environmental toxin that is more toxic than acetic, dichloroacetic, or trichloroacetic acids, is widely used in chemical industries. ...

Transplantation of glial progenitors that overexpress glutamate transporter GLT1 preserves diaphragm function following cervical SCI.

Mol. Ther. 23(3) , 533-48, (2015)

Approximately half of traumatic spinal cord injury (SCI) cases affect cervical regions, resulting in chronic respiratory compromise. The majority of these injuries affect midcervical levels, the locat...

 Synonyms

L-Methioninamide, L-valyl-L-prolyl-L-leucyl-L-prolyl-L-alanylglycylglycylglycyl-L-threonyl-L-valyl-L-leucyl-L-threonyl-L-lysyl-L-methionyl-L-tyrosyl-L-prolyl-L-arginylglycyl-L-asparaginyl-L-histidyl-L-tryptophyl-L-alanyl-L-valylglycyl-L-histidyl-L-leucyl-
MFCD00133362
L-Valyl-L-prolyl-L-leucyl-L-prolyl-L-alanylglycylglycylglycyl-L-threonyl-L-valyl-L-leucyl-L-threonyl-L-lysyl-L-methionyl-L-tyrosyl-L-prolyl-L-arginylglycyl-L-asparaginyl-L-histidyl-L-tryptophyl-L-alanyl-L-valylglycyl-L-histidyl-L-leucyl-L-methioninamide
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Gastrin-Releasing Peptide, human
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.