GRP (human) structure
|
Common Name | GRP (human) | ||
---|---|---|---|---|
CAS Number | 93755-85-2 | Molecular Weight | 2859.377 | |
Density | 1.5±0.1 g/cm3 | Boiling Point | N/A | |
Molecular Formula | C130H204N38O31S2 | Melting Point | N/A | |
MSDS | Chinese USA | Flash Point | N/A |
Use of GRP (human)Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release. |
Name | Gastrin Releasing Peptide human |
---|---|
Synonym | More Synonyms |
Description | Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release. |
---|---|
Related Catalog | |
In Vitro | Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release. However, GRP/bombesin-like immunoreactivity is widely distributed in mammalian brain, especially the hypothalamus, GI tract and in human fetal lung[1]. |
References |
Density | 1.5±0.1 g/cm3 |
---|---|
Molecular Formula | C130H204N38O31S2 |
Molecular Weight | 2859.377 |
Exact Mass | 2857.499512 |
LogP | -1.40 |
Index of Refraction | 1.672 |
Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
---|---|
RIDADR | NONH for all modes of transport |
Straightforward method to quantify GSH, GSSG, GRP, and hydroxycinnamic acids in wines by UPLC-MRM-MS.
J. Agric. Food Chem. 63(1) , 142-9, (2015) A novel, robust and fast ultrahigh performance liquid chromatography–multiple reaction monitoring mass spectrometry method has been developed for the simultaneous quantification of reduced glutathione... |
|
Chloroacetic acid triggers apoptosis in neuronal cells via a reactive oxygen species-induced endoplasmic reticulum stress signaling pathway.
Chem. Biol. Interact. 225 , 1-12, (2015) Chloroacetic acid (CA), a chlorinated analog of acetic acid and an environmental toxin that is more toxic than acetic, dichloroacetic, or trichloroacetic acids, is widely used in chemical industries. ... |
|
Transplantation of glial progenitors that overexpress glutamate transporter GLT1 preserves diaphragm function following cervical SCI.
Mol. Ther. 23(3) , 533-48, (2015) Approximately half of traumatic spinal cord injury (SCI) cases affect cervical regions, resulting in chronic respiratory compromise. The majority of these injuries affect midcervical levels, the locat... |
L-Methioninamide, L-valyl-L-prolyl-L-leucyl-L-prolyl-L-alanylglycylglycylglycyl-L-threonyl-L-valyl-L-leucyl-L-threonyl-L-lysyl-L-methionyl-L-tyrosyl-L-prolyl-L-arginylglycyl-L-asparaginyl-L-histidyl-L-tryptophyl-L-alanyl-L-valylglycyl-L-histidyl-L-leucyl- |
MFCD00133362 |
L-Valyl-L-prolyl-L-leucyl-L-prolyl-L-alanylglycylglycylglycyl-L-threonyl-L-valyl-L-leucyl-L-threonyl-L-lysyl-L-methionyl-L-tyrosyl-L-prolyl-L-arginylglycyl-L-asparaginyl-L-histidyl-L-tryptophyl-L-alanyl-L-valylglycyl-L-histidyl-L-leucyl-L-methioninamide |
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 |
Gastrin-Releasing Peptide, human |