GRP (porcine)

Modify Date: 2024-01-07 10:51:10

GRP (porcine) Structure
GRP (porcine) structure
Common Name GRP (porcine)
CAS Number 74815-57-9 Molecular Weight 2805.29
Density N/A Boiling Point N/A
Molecular Formula C126H198N38O31S2 Melting Point N/A
MSDS N/A Flash Point N/A

 Use of GRP (porcine)


GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors[1][2].

 Names

Name gastrin releasing peptide, porcine
Synonym More Synonyms

 GRP (porcine) Biological Activity

Description GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors[1][2].
Related Catalog
References

[1]. McDonald TJ, et al. The effect of gastrin-releasing peptide on the endocrine pancreas. Ann N Y Acad Sci. 1988;547:242-54.  

[2]. Bostwick DG, Bensch KG. Gastrin releasing peptide in human neuroendocrine tumours. J Pathol. 1985 Dec;147(4):237-44.  

 Chemical & Physical Properties

Molecular Formula C126H198N38O31S2
Molecular Weight 2805.29
Exact Mass 2803.45000
PSA 1123.58000
LogP 3.34950

 Synonyms

APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.
Top Suppliers:I want be here


Get all suppliers and price by the below link:

GRP (porcine) suppliers

GRP (porcine) price