74815-57-9

74815-57-9 structure

Name: GRP (porcine)
Chemical Name: gastrin releasing peptide, porcine
CAS Number: 74815-57-9
Molecular Formula: C₁₂₆H₁₉₈N₃₈O₃₁S₂
Molecular Weight: 2805.29
Catalog: Research Areas Cancer
Create Date: 2017-12-13 14:56:14
Modify Date: 2024-01-07 10:51:10
GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors[1][2].

Name	gastrin releasing peptide, porcine
Synonyms	APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2

Description	GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors[1][2].
Related Catalog	Research Areas >> Cancer Signaling Pathways >> Others >> Others
References	[1]. McDonald TJ, et al. The effect of gastrin-releasing peptide on the endocrine pancreas. Ann N Y Acad Sci. 1988;547:242-54. [2]. Bostwick DG, Bensch KG. Gastrin releasing peptide in human neuroendocrine tumours. J Pathol. 1985 Dec;147(4):237-44.