Name | gastrin releasing peptide, porcine |
---|---|
Synonyms | APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 |
Description | GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors[1][2]. |
---|---|
Related Catalog | |
References |
Molecular Formula | C126H198N38O31S2 |
---|---|
Molecular Weight | 2805.29 |
Exact Mass | 2803.45000 |
PSA | 1123.58000 |
LogP | 3.34950 |