86784-80-7

86784-80-7 structure

Name: Corticotropin-Releasing Factor, human, rat
Chemical Name: Corticotropin-releasing factor (human and rat)
CAS Number: 86784-80-7
Molecular Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂
Molecular Weight: 4757.45
Catalog: Biochemical Peptide
Create Date: 2018-09-01 11:07:59
Modify Date: 2024-01-02 16:32:47
Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary. Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2.

Name	Corticotropin-releasing factor (human and rat)
Synonyms	Human corticotropin-releasing hormone-41 Rat/human corticotropin-releasing factor Corticorelin acetate Corticorelin Human CRF(1-41) MFCD00213806 SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 Corticorelin (Human) Corticotropin-releasing factor (human)

Description	Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary. Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2.
Related Catalog	Signaling Pathways >> Others >> Others Research Areas >> Neurological Disease Peptides
In Vitro	CRF increases excitability of type II dlBNST neurons through activation of the AC-cAMP-PKA pathway, thereby causing pain-induced aversive responses[1].
In Vivo	The findings are consistent with a mechanism whereby the excess CRF that characterizes stress-related diseases initiates distinct cellular processes in male and female brains, as a result of sex-biased CRF1 signaling[2]. CRF injection on food intake (FI), CRF suppresses FI in 3-month male and female animals[3].
References	[1]. Kaneko T et al. Activation of adenylate cyclase-cyclic AMP-protein kinase A signaling by corticotropin-releasing factorwithin the dorsolateral bed nucleus of the stria terminalis is involved in pain-induced aversion. Eur J Neurosci. 2016 Sep 30. [2]. Bangasser DA et al. Corticotropin-releasing factor overexpression gives rise to sex differences in Alzheimer's disease-related signaling. Mol Psychiatry. 2016 Oct 18. [3]. Tenk J et al. Acute central effects of corticotropin-releasing factor (CRF) on energy balance: Effects of age and gender. Peptides. 2016 Nov;85:63-72.

Personal Protective Equipment	Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard Codes	Xi
RIDADR	NONH for all modes of transport
WGK Germany	3
RTECS	GM7925000