Galanin (mouse, rat)

Modify Date: 2024-01-02 11:05:36

Galanin (mouse, rat) Structure
Galanin (mouse, rat) structure
Common Name Galanin (mouse, rat)
CAS Number 114547-31-8 Molecular Weight 3164.45000
Density N/A Boiling Point N/A
Molecular Formula C141H211N43O41 Melting Point N/A
MSDS Chinese USA Flash Point N/A

 Use of Galanin (mouse, rat)


Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect[1][2].

 Names

Name Galanin (1-29) (rat, mouse)
Synonym More Synonyms

 Chemical & Physical Properties

Molecular Formula C141H211N43O41
Molecular Weight 3164.45000
Exact Mass 3162.57000
PSA 1347.03000

 Safety Information

Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR NONH for all modes of transport
WGK Germany 3

 Articles3

More Articles
Galanin is a paracrine inhibitor of gonadotroph function in the female rat.

Endocrinology 39 , 4222-4229, (1998)

Recent evidence suggests that pituitary galanin synthesized in the lactotroph is a paracrine regulator of lactotroph proliferation and PRL secretion and that these effects are mediated via a pituitary...

The GalR2 galanin receptor mediates galanin-induced jejunal contraction, but not feeding behavior, in the rat: differentiation of central and peripheral effects of receptor subtype activation.

FEBS Lett. 434 , 277-82, (1998)

The neuropeptide galanin mediates a diverse array of physiological functions through activation of specific receptors. Roles of the three recently cloned galanin receptors (GalRs) in rat intestinal co...

Pharmacological characterization of the contractile effects of galanin (1-29)-NH2, galantide and galanin (1-14)-(alpha-aminobutyric acid8)scyliorhinin-I in the rat gastric fundus.

Fundam. Clin. Pharmacol. 11 , 576, (1997)

Porcine galanin (1-29)-NH2, galantide (M15) and galanin (1-14)-(alpha-aminobutyric acid8)-scyliorhinin-I used in concentrations of 300, 1,000 and 3,000 nM respectively caused contractions of rat fundu...

 Synonyms

GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2
Rat galanin
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
GALANIN,RAT
Top Suppliers:I want be here



Get all suppliers and price by the below link:

Galanin (mouse, rat) suppliers

Galanin (mouse, rat) price