Galanin (mouse, rat)
Galanin (mouse, rat) structure
|
Common Name | Galanin (mouse, rat) | ||
|---|---|---|---|---|
| CAS Number | 114547-31-8 | Molecular Weight | 3164.45000 | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | C141H211N43O41 | Melting Point | N/A | |
| MSDS | Chinese USA | Flash Point | N/A | |
Use of Galanin (mouse, rat)Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect[1][2]. |
| Name | Galanin (1-29) (rat, mouse) |
|---|---|
| Synonym | More Synonyms |
| Description | Galanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect[1][2]. |
|---|---|
| Related Catalog | |
| References |
| Molecular Formula | C141H211N43O41 |
|---|---|
| Molecular Weight | 3164.45000 |
| Exact Mass | 3162.57000 |
| PSA | 1347.03000 |
| InChIKey | JHQDYHHNJBOXKP-UHFFFAOYSA-N |
| SMILES | CCC(C)C(NC(=O)C(C)NC(=O)C(Cc1c[nH]cn1)NC(=O)C1CCCN1C(=O)CNC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(Cc1ccc(O)cc1)NC(=O)CNC(=O)C(C)NC(=O)C(CO)NC(=O)C(CC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(Cc1c[nH]c2ccccc12)NC(=O)CN)C(C)O)C(=O)NC(CC(=O)O)C(=O)NC(CC(N)=O)C(=O)NC(Cc1c[nH]cn1)C(=O)NC(CCCNC(=N)N)C(=O)NC(CO)C(=O)NC(Cc1ccccc1)C(=O)NC(CO)C(=O)NC(CC(=O)O)C(=O)NC(CCCCN)C(=O)NC(Cc1c[nH]cn1)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C(N)=O)C(C)O |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| RIDADR | NONH for all modes of transport |
| WGK Germany | 3 |
|
Galanin is a paracrine inhibitor of gonadotroph function in the female rat.
Endocrinology 39 , 4222-4229, (1998) Recent evidence suggests that pituitary galanin synthesized in the lactotroph is a paracrine regulator of lactotroph proliferation and PRL secretion and that these effects are mediated via a pituitary... |
|
|
The GalR2 galanin receptor mediates galanin-induced jejunal contraction, but not feeding behavior, in the rat: differentiation of central and peripheral effects of receptor subtype activation.
FEBS Lett. 434 , 277-82, (1998) The neuropeptide galanin mediates a diverse array of physiological functions through activation of specific receptors. Roles of the three recently cloned galanin receptors (GalRs) in rat intestinal co... |
|
|
Pharmacological characterization of the contractile effects of galanin (1-29)-NH2, galantide and galanin (1-14)-(alpha-aminobutyric acid8)scyliorhinin-I in the rat gastric fundus.
Fundam. Clin. Pharmacol. 11 , 576, (1997) Porcine galanin (1-29)-NH2, galantide (M15) and galanin (1-14)-(alpha-aminobutyric acid8)-scyliorhinin-I used in concentrations of 300, 1,000 and 3,000 nM respectively caused contractions of rat fundu... |
| GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 |
| GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2 |
| Rat galanin |
| H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 |
| GALANIN,RAT |