< Property Suppliers>

GastrinReleasingPeptidehuman

Product detail:

Published date: 2026-01-20 08:38:36

CAS number: 93755-85-2

Name: GRP (human)

Price:

Purity: 98.0%

Stocking period: 10 Day

Stock: In Stock

Supplier/Manufacture:

Name: Shanghai Nianxing Industrial Co., Ltd Recommended

Chemsrc Level: Verified

Product #: 403768

Tel: 18916513247

Address: 2222 Huancheng Road, Juyuan New District, Jiading District, Shanghai

Area: China(Mainland)

Contact: Yang

Contact Phone #: 0086-021-52280163

Email: sales@echemcloud.com

Website: http://www.echemcloud.com

Major Market:

Annual Trade Volume:

Foreign Trade % of Salers:

Major partners:

Detail introduction:

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:

Contact: Yang

Product Detail: GastrinReleasingPeptidehuman


Get all suppliers by the below link:

GRP (human) suppliers

Price from the other suppliers:

2018-02-02 VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2

2024-05-30 GRP (human)

2020-10-28 Gastrin-Releasing Peptide, human

2021-02-06 GRP (human)

Get all price from the following link:

GRP (human) price