< Property Suppliers>

Gastrin-Releasing Peptide, human

Product detail:

Published date: 2025-08-23 13:14:36

CAS number: 93755-85-2

Name: GRP (human)

Price:
¥Inquiry/1mg ¥Inquiry/50mg ¥Inquiry/100g ¥Inquiry/1kg

Purity: 95.0%

Stocking period: Inquiry

Stock: Inquiry

Product Webpage: http://www.ontoresinc.cn/Product_Gastrin-ReleasingPeptide_3527.html

Supplier/Manufacture:

Name: Ontores Biotech

Chemsrc Level: Unverified

Product #: 49

Tel: 0571-88760729

Address: 1378 Wenxi Road, Canggu Street, Yuhang District, Hangzhou, Zhejiang Province, China

Area: China(Mainland)

Contact: fang liu

Contact Phone #: 18072970094

Email: 1948865295@qq.com

Website: http://www.ontoresinc.cn/

Annual Trade Volume:

Foreign Trade % of Salers:

Major partners:

Detail introduction:

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
¥Inquiry/1mg ¥Inquiry/50mg ¥Inquiry/100g ¥Inquiry/1kg

Contact: Yang

Product Detail: GastrinReleasingPeptidehuman


Get all suppliers by the below link:

GRP (human) suppliers

Price from the other suppliers:

2024-07-15 GastrinReleasingPeptidehuman

2018-02-02 VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2

2024-05-30 GRP (human)

2021-02-06 GRP (human)

Get all price from the following link:

GRP (human) price