< Property Suppliers>

GRP (human)

Product detail:

Published date: 2025-08-29 20:50:44

CAS number: 93755-85-2

Name: GRP (human)

Price:
¥1789.0/1mg ¥6229.0/5mg

Purity: 98.0%

Stocking period: 2 Day

Stock: In Stock

Product Webpage: http://www.med-bio.cn/product/2521.html

Supplier/Manufacture:

Name: Shanghai MedBio Inc

Chemsrc Level: Unverified

Product #: 16777

Tel: 021-4001861816

Address: ChanghongRd

Area: China(Mainland)

Contact: cici

Contact Phone #: 18916172912

Email: order@med-bio.cn

Website: http://www.med-bio.cn

Major Market:

Annual Trade Volume:

Foreign Trade % of Salers:

Major partners:

Detail introduction:

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
¥1789.0/1mg ¥6229.0/5mg

Contact: Yang

Product Detail: GastrinReleasingPeptidehuman


Get all suppliers by the below link:

GRP (human) suppliers

Price from the other suppliers:

2024-07-15 GastrinReleasingPeptidehuman

2018-02-02 VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2

2024-05-30 GRP (human)

2020-10-28 Gastrin-Releasing Peptide, human

Get all price from the following link:

GRP (human) price