< Property Suppliers>

TIP 39, Tuberoinfundibular Neuropeptide

Product detail:

Published date: 2024-01-09 21:17:46

CAS number: 277302-47-3

Name: TIP-39 trifluoroacetate salt

Price:
¥Inquiry/1g

Purity: 98.9%

Stocking period: 1 Day

Stock: In Stock

Product Webpage: https://www.dcchemicals.com/product_show-tip-39-tuberoinfundibular-neuropeptide.html

Detail Product Information:
TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R).

Supplier/Manufacture:

Name: DC Chemicals Limited Recommended

Chemsrc Level: Verified

Product #: 34963

Tel: 58447131

Address: Jinyu Rd100, pudong

Area: China(Mainland)

Contact: Tony Cao

Contact Phone #: 13564518121

Email: sales@dcchemicals.com

Website: http://www.dcchemicals.com

Major Market:

Foreign Trade % of Salers:

Major partners:

Detail introduction:
D&C Chemicals provides a wide range of research chemicals and biochemicals including novel life-science reagents, reference compounds, APIs and Natural compounds for laboratory and scientific use.



D&C Chem has established a global network of thousands of customers from many research centers and Reagent companies in the USA, Europe and Japan.

We are the the official vendor of more than 500 universities and institutes including: Harvard University,Yale University,NIH/NCI, City of Hope ORG, PARTNERS ORG,John Hopkins University,Universit tsklinikum,Oxford University,Newcastle University,UNC,UCSF and many other universities and institutes. Our bioactive compounds received good feedback from our customers.





Our credo is committed to the adoption of different products, reliable quality, competitive prices and quality service to create value for customers.

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
¥Inquiry/1g

Contact: Yang

Product Detail: TIP 39, Tuberoinfundibular Neuropeptide


Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:
¥Inquiry/1g

Contact: Jackie Yang

Product Detail: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP


Name: DC Chemicals Limited

Area: China

Price:
¥Inquiry/1g

Contact: Tony Cao

Product Detail: TIP 39, Tuberoinfundibular Neuropeptide


Get all suppliers by the below link:

TIP-39 trifluoroacetate salt suppliers

Price from the other suppliers:

2024-07-15 TIP 39, Tuberoinfundibular Neuropeptide

2018-01-27 SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

2024-05-30 TIP-39 trifluoroacetate salt

Get all price from the following link:

TIP-39 trifluoroacetate salt price