TIP-39 trifluoroacetate salt

Names

[ Name ]:
TIP-39 trifluoroacetate salt

[Synonym ]:
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Biological Activity

[Description]:

TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1].

[Related Catalog]:

Signaling Pathways >> GPCR/G Protein >> Adenylate Cyclase

Research Areas >> Neurological Disease

[References]

[1]. Della Penna K, et al. Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor. Neuropharmacology. 2003 Jan;44(1):141-53.

Chemical & Physical Properties

[ Molecular Formula ]:
C₂₀₂H₃₂₅N₆₁O₅₄S

Related Compounds

The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.