< Property Suppliers>

SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Product detail:

Published date: 2026-07-11 17:08:21

CAS number: 277302-47-3

Name: TIP-39 trifluoroacetate salt

Price:
$Inquiry/1kg

Purity: 98.0%

Stocking period: Inquiry

Stock: Inquiry

Detail Product Information:
TIP 39, Tuberoinfundibular Neuropeptide | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP|277302-47-3

Product Name: TIP 39, Tuberoinfundibular Neuropeptide;SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Molecular Formula:C202H325N61O54S
CAS No.: 277302-47-3
Package:100mg, 1g, 10g

TIP 39, Tuberoinfundibular Neuropeptide | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP|277302-47-3

Supplier/Manufacture:

Name: GL Biochem (Shanghai) Ltd.

Chemsrc Level: Unverified

Product #: 4292

Tel: 021-61263452

Address: No.519 Ziyue Road, Shanghai, 200241, China

Area: China(Mainland)

Contact: Jackie Yang

Contact Phone #: 13641803416

Email: ymbetter@glbiochem.com

Website: http://www.glbiochem.com

Annual Trade Volume: 2000000000RMB

Foreign Trade % of Salers: 65%

Major partners:

Detail introduction:
During the past 20 years, GL Biochem has been recognized with many ‎scientific and technological achievement awards at Provincial and Country levels, 20 Chinese patents, and published over 20 papers in scientific journals.

GL Biochem utilizes many state-of-the-art and highly sophisticated peptide instruments able to produce more than 10,000 peptides per month. Our machines include 400Hz NMR, 2 units of FT-IR, 10 units of MS, Amino Acid Analyzer, 96/102 well automated peptide synthesizers, microwave-assisted peptide synthesizers, microplate readers, and 200 units of analytical and preparative HPLC.

GL Biochem has become the largest and most recognized producer of peptide reagents, custom peptides and antibodies worldwide. We are renowned among international and domestic customers for having the most complete listing of peptide related products ever offered! In addition we stock standard products and can usually produce a custom peptide in less than 2 weeks.

As part of our expansion plans, GL Biochem has successfully acquired an antibody manufacturing company in 2008 and added fast-growing antibody products into our business portfolio. In 2011, we also acquired an Australian peptide company. This acquisition not only further substantiated our position as the top ranking peptide company in the world, but also enlarged our technical and sales superiority in the peptide business arena!

We would like to express our appreciation for the support given by our Chinese government. Top National Chinese leaders such as Mr. Jiang Zemin, Mr. Hu Jintao, Mr. Xi Jinping have visited GL Biochem or met with GL Biochem senior management. The government of China has recognized how critical peptide research is to Chinese researchers along with all researchers worldwide and is committed to supporting us.

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
$Inquiry/1kg

Contact: Yang

Product Detail: TIP 39, Tuberoinfundibular Neuropeptide


Get all suppliers by the below link:

TIP-39 trifluoroacetate salt suppliers

Price from the other suppliers:

2024-07-15 TIP 39, Tuberoinfundibular Neuropeptide

2024-05-30 TIP-39 trifluoroacetate salt

Get all price from the following link:

TIP-39 trifluoroacetate salt price