Corticotropin-Releasing Factor, human, rat

Names

[ Name ]:
Corticotropin-Releasing Factor, human, rat

[Synonym ]:
Human corticotropin-releasing hormone-41
Rat/human corticotropin-releasing factor
Corticorelin acetate
Corticorelin
Human CRF(1-41)
MFCD00213806
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Corticorelin (Human)
Corticotropin-releasing factor (human)

Biological Activity

[Description]:

Corticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary. Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2.

[Related Catalog]:

Signaling Pathways >> Others >> Others

Research Areas >> Neurological Disease

Peptides

[In Vitro]

CRF increases excitability of type II dlBNST neurons through activation of the AC-cAMP-PKA pathway, thereby causing pain-induced aversive responses[1].

[In Vivo]

The findings are consistent with a mechanism whereby the excess CRF that characterizes stress-related diseases initiates distinct cellular processes in male and female brains, as a result of sex-biased CRF1 signaling[2]. CRF injection on food intake (FI), CRF suppresses FI in 3-month male and female animals[3].

[References]

[1]. Kaneko T et al. Activation of adenylate cyclase-cyclic AMP-protein kinase A signaling by corticotropin-releasing factorwithin the dorsolateral bed nucleus of the stria terminalis is involved in pain-induced aversion. Eur J Neurosci. 2016 Sep 30.

[2]. Bangasser DA et al. Corticotropin-releasing factor overexpression gives rise to sex differences in Alzheimer's disease-related signaling. Mol Psychiatry. 2016 Oct 18.

[3]. Tenk J et al. Acute central effects of corticotropin-releasing factor (CRF) on energy balance: Effects of age and gender. Peptides. 2016 Nov;85:63-72.

[Related Small Molecules]

Chemical & Physical Properties

[ Molecular Formula ]:
C₂₀₈H₃₄₄N₆₀O₆₃S₂

[ Molecular Weight ]:
4757.45

[ Storage condition ]:
−20°C

Safety Information

[ Personal Protective Equipment ]:
Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter

[ Hazard Codes ]:
Xi

[ RIDADR ]:
NONH for all modes of transport

[ WGK Germany ]:
3

[ RTECS ]:
GM7925000

Articles

Effects of corticotrophin releasing hormone (CRH) on cell viability and differentiation in the human BeWo choriocarcinoma cell line: a potential syncytialisation inducer distinct from cyclic adenosine monophosphate (cAMP).

Reprod. Biol. Endocrinol. 11 , 30, (2013)

Placental production of corticotrophin releasing hormone (CRH) rises exponentially as pregnancy progresses, and has been linked with the onset of normal and preterm labour. CRH is produced in syncytio...

Modulation of Sleep Homeostasis by Corticotropin Releasing Hormone in REM Sleep-Deprived Rats.

Int. J. Endocrinol. 2010 , 326151, (2010)

Studies have shown that sleep recovery following different protocols of forced waking varies according to the level of stress inherent to each method. Sleep deprivation activates the hypothalamic-pitu...

Identification of a novel interaction between corticotropin releasing hormone (Crh) and macroautophagy.

Sci. Rep. 6 , 23342, (2016)

In inflammatory bowel disease (IBD), compromised restitution of the epithelial barrier contributes to disease severity. Owing to the complexity in the pathogenesis of IBD, a variety of factors have be...

Related Compounds

The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.