Corticotropin Releasing Factor (148-188), ovine

Names

[ Name ]:
Corticotropin Releasing Factor (148-188), ovine

[Synonym ]:
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Corticotropin Releasing Factor (148-188), ovine

Biological Activity

[Description]:

Corticotropin-releasing hormone (CRH) is a peptide hormone involved in stress responses. Corticotropin-releasing factor (CRF) is a major regulatory peptide in the hypothalamic-pituitary-adrenal (HPA) axis under stress conditions. Corticotropin-releasing hormone (CRH) can be used for the research of neuroendocrine and anxiety-like behaviors[1][2].

[Related Catalog]:

Signaling Pathways >> Others >> Others

Research Areas >> Neurological Disease

Chemical & Physical Properties

[ Molecular Formula ]:
C₂₀₅H₃₃₉N₅₉O₆₃S

[ Molecular Weight ]:
4670.38

[ Storage condition ]:
-20°C

Safety Information

[ Personal Protective Equipment ]:
Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter

[ Hazard Codes ]:
Xi

[ RIDADR ]:
NONH for all modes of transport

[ WGK Germany ]:
3.0

Articles

Neurokinin B signaling in the female rat: a novel link between stress and reproduction.

Endocrinology 155(7) , 2589-601, (2014)

Acute systemic stress disrupts reproductive function by inhibiting pulsatile gonadotropin secretion. The underlying mechanism involves stress-induced suppression of the GnRH pulse generator, the funct...

Expression and regulation of neuromedin B in pituitary corticotrophs of male melanocortin 2 receptor-deficient mice.

Endocrinology 155(7) , 2492-9, (2014)

The hypothalamic-pituitary-adrenal (HPA) axis is a major part of the neuroendocrine system that controls responses to stress, and has an important function in the regulation of various body processes....

Bisphenol A differentially activates protein kinase C isoforms in murine placental tissue

Toxicol. Appl. Pharmacol. 269(2) , 163-8, (2013)

Bisphenol A is utilized to make polycarbonate plastics and is an environmental pollutant. Recent research has indicated that it is an endocrine disruptor and may interfere with reproductive processes....

Related Compounds

The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.