<Suppliers Price>

Cecropin A

Names

[ CAS No. ]:
80451-04-3

[ Name ]:
Cecropin A

[Synonym ]:
H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

Biological Activity

[Description]:

Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.

[Related Catalog]:

Signaling Pathways >> Anti-infection >> Bacterial
Research Areas >> Infection
Research Areas >> Cancer
Research Areas >> Inflammation/Immunology
Peptides

[Target]

Bacterial[2]


[In Vitro]

Cecropin A shows anticancer activity. Cecropin A (10-50 μM) dose-dependently reduces the viability of HL-60 cells. Cecropin A (30 μM) promotes ROS production, causes mitochondrial membrane potential (Δψm) collapse, and generates morphological changes in nuclear chromatin in HL-60 cells. Cecropin A (30 μM) also leads to an early apoptosis and cuases caspase-independent cell death in HL-60 cells[1]. Cecropin A has cytotoxicity on gram negative bacteria, including A. baumanii (CCARM 12005, CCARM 12035, CCARM 12036, CCARM 12037) with minimal inhibitory concentration (MIC) of 0.5-1 μM. Cecropin A (25 μM) significantly blocks the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA and slightly inhibited the expression of mMIP-1 mRNA in RAW264.7 cells. Cecropin A (0.1, 0.25, 0.5, 1, 2.5, 5 μM) also inhibits NO production and reduces mTNF-α cytokine levels in LPS-stimulated RAW264.7 cells, and exihibits anti-inflammatory activity[2].

[Cell Assay]

Briefly, 5 × 105 cells/mL in RPMI 1640 supplemented with 10% heat-inactivated FCS are placed onto 96-well plates. Cecropin A is added to cell cultures at a final concentration of 10, 20, 30, 40 and 50 μM and cells are incubated for 24 h at 37°C in a humidified atmosphere with 5% CO2. Then, 20 μL MTT (0.5 mg/mL) is added to each well and the plate is incubated for 4 h at 37°C. The MTT solution is removed and isopropyl alcohol containing 0.04 N hydrochloric acid is added to each well to dissolve the formazan crystal. Absorbance is determined on a spectrophotometric microplate reader at a test wavelength of 550 nm and a reference wavelength of 620 nm. The absorbance of the cells incubated in the absence of cecropin A (untreated cells) is set at 100%. Results are expressed as percentage of cell viability[1].

[References]

[1]. Cerón JM, et al. The antimicrobial peptide cecropin A induces caspase-independent cell death in human promyelocytic leukemia cells. Peptides. 2010 Aug;31(8):1494-503.

[2]. Lee E, et al. Anti-inflammatory activities of cecropin A and its mechanism of action. Arch Insect Biochem Physiol. 2015 Jan;88(1):31-44.


[Related Small Molecules]

Puromycin 2HCl | Geneticin | Tunicamycin | Hygromycin B | Salinomycin | Avibactam sodium | Neomycin sulfate | Vaborbactam | Methicillin SodiuM | Rifampicin | Metronidazole | Carbenicillin disodium | Ceftazidime | Eravacycline dihydrochloride | cefotaxime sodium

Chemical & Physical Properties

[ Molecular Formula ]:
C184H313N53O46

[ Molecular Weight ]:
4003.78

[ Appearance of Characters ]:
powder

[ Storage condition ]:
−20°C

Safety Information

[ Personal Protective Equipment ]:
Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter

[ RIDADR ]:
NONH for all modes of transport

[ WGK Germany ]:
3

Articles

Lysylated phospholipids stabilize models of bacterial lipid bilayers and protect against antimicrobial peptides.

Biochim. Biophys. Acta 1838(9) , 2198-204, (2014)

Aminoacylated phosphatidylglycerols are common lipids in bacterial cytoplasmic membranes. Their presence in Staphylococcus aureus has been linked to increased resistance to a number of antibacterial a...

Rgn gene is required for gut cell homeostasis after ingestion of sodium dodecyl sulfate in Drosophila.

Gene 549(1) , 141-8, (2014)

Resistance and resilience constitute the two complementary aspects of epithelial host defenses in Drosophila. Epithelial cell homeostasis is necessary for the recovery of damages caused by stress or i...

In vitro activities of antibiotics and antimicrobial cationic peptides alone and in combination against methicillin-resistant Staphylococcus aureus biofilms.

Antimicrob. Agents Chemother. 56(12) , 6366-71, (2012)

Methicillin-resistant Staphylococcus aureus (MRSA) strains are most often found as hospital- and community-acquired infections. The danger of MRSA infections results from not only the emergence of mul...


More Articles


Related Compounds

The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.