| Name | beta-amyloid (1-43) |
|---|---|
| Synonyms |
a-beta (1-43)
daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvviat beta-amyloid (1-43) amyloid beta-protein (1-43) MFCD00240623 beta-amyloid peptide [1-43], human beta-amyloid (1-43) peptide h-asp-ala-glu-phe-arg-his-asp-ser-gly-tyr-glu-val-his-his-gln-lys-leu-val-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-val-val-ile-ala-thr-oh h2n-d-a-e-f-r-h-d-s-g-y-e-v-h-h-q-k-l-v-f-f-a-e-d-v-g-s-n-k-g-a-i-i-g-l-m-v-g-g-v-v-i-a-t-oh |
| Description | Amyloid β-Peptide(1-43) human, the Human β-amyloid peptide, is minor component of neuritic plaques found in brains of patients with Alzheimer's disease. |
|---|
| Molecular Formula | C207H318N56O62S |
|---|---|
| Molecular Weight | 4615.211 |
| Exact Mass | 4614.324 |
| Storage condition | −20°C |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| RIDADR | NONH for all modes of transport |
| WGK Germany | 3 |