Amyloid β-Protein (1-43)
Modify Date: 2024-01-09 17:01:35
Amyloid β-Protein (1-43) structure
|
Common Name | Amyloid β-Protein (1-43) | ||
|---|---|---|---|---|
| CAS Number | 134500-80-4 | Molecular Weight | 4615.211 | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | C207H318N56O62S | Melting Point | N/A | |
| MSDS | USA | Flash Point | N/A | |
Use of Amyloid β-Protein (1-43)Amyloid β-Peptide(1-43) human, the Human β-amyloid peptide, is minor component of neuritic plaques found in brains of patients with Alzheimer's disease. |
| Name | beta-amyloid (1-43) |
|---|---|
| Synonym | More Synonyms |
| Description | Amyloid β-Peptide(1-43) human, the Human β-amyloid peptide, is minor component of neuritic plaques found in brains of patients with Alzheimer's disease. |
|---|
| Molecular Formula | C207H318N56O62S |
|---|---|
| Molecular Weight | 4615.211 |
| Exact Mass | 4614.324 |
| Storage condition | −20°C |
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| RIDADR | NONH for all modes of transport |
| WGK Germany | 3 |
|
Neurodegeneration induced by beta-amyloid peptides in vitro: the role of peptide assembly state.
J. Neurosci. 13 , 1676, (1993) The progressive neurodegeneration of Alzheimer's disease has been hypothesized to be mediated, at least in part, by beta-amyloid protein. A relationship between the aggregation state of beta-amyloid p... |
| a-beta (1-43) |
| daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvviat |
| beta-amyloid (1-43) |
| amyloid beta-protein (1-43) |
| MFCD00240623 |
| beta-amyloid peptide [1-43], human |
| beta-amyloid (1-43) peptide |
| h-asp-ala-glu-phe-arg-his-asp-ser-gly-tyr-glu-val-his-his-gln-lys-leu-val-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-val-val-ile-ala-thr-oh |
| h2n-d-a-e-f-r-h-d-s-g-y-e-v-h-h-q-k-l-v-f-f-a-e-d-v-g-s-n-k-g-a-i-i-g-l-m-v-g-g-v-v-i-a-t-oh |
- DC Chemicals Limited
- China
- Product Name: Amyloid β-Peptide(1-43)(human) TFA
- Price: $Inquiry/250mg $Inquiry/100mg $Inquiry/1g
- Purity: 98.0%
- Stocking Period: 3 Day
- Contact: Tony Cao
- Zhejiang Hangyu API Co., Ltd
- China
- Product Name: Amyloid β-Protein (1-43)/β-Amyloid (1-43)
- Price: $Inquiry/1kg
- Purity: 99.0%
- Stocking Period: 1 Day
- Contact: Vinnie
Get all suppliers and price by the below link: