GLP-1 (7-37)

Names

[ Name ]:
GLP-1 (7-37)

[Synonym ]:
Preproglucagon 78-108
HuMan GLP-1
Glycine, L-histidyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alany l-L-alanyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-N-(diaminomethylene)-L-ornithyl-
L-Histidyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alany l-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-N-(diaminomethylene)-L-ornithylglycine
PREPROGLUCAGON 78-108 HUMAN
Tglp-1
GLP-1,7-37
insulinotropin
HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
GLP-1 (7-37) Acetate
GLP-1(7-37)
Human GLP-1 (7-37)

Biological Activity

[Description]:

GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. Sequence: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly.

[Related Catalog]:

Signaling Pathways >> GPCR/G Protein >> Glucagon Receptor

Research Areas >> Others

Peptides

[In Vivo]

GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion[1]. An intravenous (IV) infusion of GLP-1(7-37) at 0.5, 5, or 50 pmol/min/kg during the second hour of a 2-hour 11-mmol/L hyperglycemic clamp in Sprague-Dawley rats produces a dose-related enhancement of the glucose-induced increase in plasma insulin concentration. Infusion of GLP-1(7-37) (5 pmol/min/kg IV) during a hyperglycemic clamp at two sequentially increasing concentrations of glucose, 11 and 17 mmol/L, produces incremental increases in insulin of 600 and 1,200 pM, respectively. Similarly, infusion of GLP-1(7-37) in hyperinsulinemic, hyperglycemic Zucker diabetic fatty (ZDF) rats produces a transitory increase in plasma insulin concentration and normalizes the plasma glucose concentration. Infusion of GLP-1(7-37) in rats maintains at 11 mM glucose results in a sustained approximately twofold enhancement of the plasma insulin concentration. In rats infused with GLP-1(7-37) for 5 days at 15 pmol/min/kg, there is a small increase in basal plasma insulin concentration and no effect on glucose[2].

[Animal admin]

Rats[2] All experiments are conducted in conscious, catheterized, male Sprague-Dawley rats weighing 300 to 350 g or control rats (body weights, 280 to 320 and 220 to 260 g, respectively). GLP-1(7-37) is infused at 0.5, 5, or 50 pmol/min/kg IV during the second hour of a 2-hour 11-mM hyperglycemic clamp. Glucose (50% solution) is infused at a variable rate to maintain plasma glucose concentration at 11 mM. GLP-1(7-37) (5 pmol/rnin/kg) or vehicle (2% heat-inactivated serum plus 1% sodium acetate in normal saline) is infused via the jugular catheter for 60 minutes[2].

[References]

[1]. Sarrauste de Menthiere, C. et al. Structural requirements of the N-terminal region of GLP-1-[7-37]-NH2 for receptor interaction and cAMP production. European journal of medicinal chemistry 39, 473-480, doi:10.1016/j.ejmech.2004.02.002 (2004).

[2]. Hargrove DM, et al. Glucose-dependent action of glucagon-like peptide-1 (7-37) in vivo during short- or long-term administration. Metabolism. 1995 Sep;44(9):1231-7.

[Related Small Molecules]

Chemical & Physical Properties

[ Density]:
1.5±0.1 g/cm3

[ Molecular Formula ]:
C₁₅₁H₂₂₈N₄₀O₄₇

[ Molecular Weight ]:
3355.666

[ Exact Mass ]:
3353.667969

[ PSA ]:
1408.40000

[ LogP ]:
-3.86

[ Index of Refraction ]:
1.660

[ Storage condition ]:
−20°C

[ Water Solubility ]:
Soluble in water at 2mg/ml

Safety Information

[ Safety Phrases ]:
22-24/25

[ WGK Germany ]:
3

GLP-1 (7-37)

Names

Biological Activity

Chemical & Physical Properties

Safety Information

Related Compounds