H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

Published date: 2024-07-15 12:32:44

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Amyloid β-Protein (1-42) (mouse, rat) CAS# 166090-74-0
Price Purity 95.0%
Stocking
Period
10 Day Stock In Stock
 Detail Product Information
Chemical & Physical Properties:
CAS Number: 166090-74-0
Name: Amyloid β-Protein (1-42) (mouse, rat)
Molecular Formula: C199H307N53O59S
Molecular Weight: 4418.017
Density: N/A
Boiling Point: N/A
Melting Point: N/A
Flash Point: N/A

Supplier/Manufacture

Shanghai Nianxing Industrial Co., Ltd verified supplier

Chemsrc Level: Verified
Product #: 403768
Tel: 18916513247
Address: 2222 Huancheng Road, Juyuan New District, Jiading District, Shanghai
Area: China
Contact: Yang
Contact Phone #: 0086-021-52280163
Email: sales@echemcloud.com
Website: http://www.echemcloud.com
Major Market:
Annual Trade Volume:
Foreign Trade % of Sales:
Major partners:
Top Suppliers:

Get all suppliers by the below link:

Amyloid β-Protein (1-42) (mouse, rat) suppliers


Price: $200/500ug
Price from the other suppliers:

Get all price from the following link:

Amyloid β-Protein (1-42) (mouse, rat)price