Exendin-4 (3-39)

Published date: 2020-12-02 10:36:42

Exendin-4 (3-39) Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Exendin-4 (3-39) CAS# 196109-31-6
Price ¥Inquiry/1kg ¥Inquiry/5g ¥Inquiry/100mg Purity 99.0%
Stocking
Period
Inquiry Stock Inquiry
 Detail Product Information
Chemical & Physical Properties:
CAS Number: 196109-31-6
Name: Exendin-4 (3-39)
Molecular Formula: C176H272N46O58S
Molecular Weight:
Density: N/A
Boiling Point: N/A
Melting Point: N/A
Flash Point: N/A

Supplier/Manufacture

Bankpeptide Biological Technology Co., Ltd

Chemsrc Level: Unverified
Tel: 0551-62626599
Address: Floor 4,C6 Science and Technology Industrial Park, No. 168 Xiangzhang Road, Hefei hi-tech Dist, Anhui province, China
Area: China
Contact: bankpeptide
Contact Phone #: 0551-62626599
Email: peptide50@bankpeptide.net
Website: http://
Major Market:
Annual Trade Volume:
Foreign Trade % of Sales:
Major partners:
Bankpeptide biological technology co.,LTD(short for: Bankpeptide) was founded in 2014,which is a national high-tech enterprise engaging in the research ,development, production and sales of peptide products as well as peptide technology transfer. At the beginning of the establishment, Bankpeptide has successfully acquired a number of domestic peptides&antibody companies.Now Bankpeptide is the largest professional production enterprises in peptide synthesis, antibody preparation, protein expression .

The creation of the Bankpeptide originated from the company's identification of the future development of the peptide industry.Withing the sense of responsibility and mission of the industry, Bankpeptide determined to establish a national brand in the global scope to lead the healthy and rapid development of peptide industry.

Bankpeptide enhances the core competitiveness of enterprises with scientific and technological innovation as a driving force. In the first year, Bankpeptide broke peptide fast and large-scale production technology bottlenecks through peptide production facilities improvement and independent innovation of peptide research and development,forming a seven utility model patents and two invention patents. Main products applied to the tumor, treatment of diabetes, cardiovascular and cerebrovascular diseases, as well as animal immunity, protein electrophoresis, phosphorylation research and enzyme . The market of products cover the various provinces and cities nationwide, autonomous regions, also exported to Europe, America, Middle East, Hong Kong, Macao and Taiwan and other regions.

Our R & D innovation team consists of a team of industry leading talent. Meanwhile the master of R & D personnel accounted for more than 15% of the total number of employees at the same time. The company also invited domestic and foreign top biomedical scientists as scientific advisor. The company is equipped with first-class precision instruments in peptide synthesis, purification, freeze-drying, quality inspection and analysis .We have introduced LC-MS LC-MS, ultra high pressure liquid chromatography, ultraviolet spectrophotometer and other special equipment from the United States, Japan and other countries. Sincere attitude, comprehensive professional services, powerful hardware and software support promote the company to establish a cooperative relationship with more than 100 domestic and foreign research institutions and pharmaceutical enterprises.

Bankpeptide adheres to the "quality first, service first" business philosophy.With professional R & D team, leading technology, advanced equipment, We commit to provide high quality peptide products and technical services for researchers and large pharmaceutical companies, and strive to build a global peptide leading brand with core competitiveness .
Top Suppliers:


Get all suppliers by the below link:

Exendin-4 (3-39) suppliers

Price from the other suppliers:
2018-02-19 EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Price: $Inquiry
2021-07-26 EXENDIN-4 (3-39)
Price: $Inquiry

Get all price from the following link:

Exendin-4 (3-39)price