Exendin-4 (3-39)

Modify Date: 2025-08-20 13:19:29

Exendin-4 (3-39) Structure
Exendin-4 (3-39) structure
Common Name Exendin-4 (3-39)
CAS Number 196109-31-6 Molecular Weight N/A
Density N/A Boiling Point N/A
Molecular Formula C176H272N46O58S Melting Point N/A
MSDS N/A Flash Point N/A

 Use of Exendin-4 (3-39)


Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2].

 Names

Name Exendin-4 (3-39)
Synonym More Synonyms

 Exendin-4 (3-39) Biological Activity

Description Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis[1][2].
Related Catalog
In Vivo GLP-1 (i.p.; 5 μg/kg) increases circulating corticosterone and aldosterone levels[2]. Animal Model: Rats[2] Dosage: 5 μg/kg Administration: Intraperitoneal injections Result: Increased circulating corticosterone levels in a time-dependent manner both in conscious and anaesthetized rats and also increased aldosterone levels.

 Chemical & Physical Properties

Molecular Formula C176H272N46O58S

 Synonyms

EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.
Top Suppliers:I want be here



Get all suppliers and price by the below link:

Exendin-4 (3-39) suppliers

Exendin-4 (3-39) price