< Property Suppliers>

Exendin-4 (3-39)

Product detail:

Published date: 2024-09-28 17:26:06

CAS number: 196109-31-6

Name: Exendin-4 (3-39)

Price:
¥Inquiry/1kg ¥Inquiry/5g ¥Inquiry/100mg

Purity: 99.0%

Stocking period: Inquiry

Stock: Inquiry

Supplier/Manufacture:

Name: Bankpeptide Biological Technology Co., Ltd

Chemsrc Level: Unverified

Product #: 54

Tel: 0551-62626599

Address: Floor 4,C6 Science and Technology Industrial Park, No. 168 Xiangzhang Road, Hefei hi-tech Dist, Anhui province, China

Area: China(Mainland)

Contact: bankpeptide

Contact Phone #: 0551-62626599

Email: peptide50@bankpeptide.net

Website: http://

Major Market:

Annual Trade Volume:

Foreign Trade % of Salers:

Major partners:

Detail introduction:
Bankpeptide biological technology co.,LTD(short for: Bankpeptide) was founded in 2014,which is a national high-tech enterprise engaging in the research ,development, production and sales of peptide products as well as peptide technology transfer. At the beginning of the establishment, Bankpeptide has successfully acquired a number of domestic peptides&antibody companies.Now Bankpeptide is the largest professional production enterprises in peptide synthesis, antibody preparation, protein expression .

The creation of the Bankpeptide originated from the company's identification of the future development of the peptide industry.Withing the sense of responsibility and mission of the industry, Bankpeptide determined to establish a national brand in the global scope to lead the healthy and rapid development of peptide industry.

Bankpeptide enhances the core competitiveness of enterprises with scientific and technological innovation as a driving force. In the first year, Bankpeptide broke peptide fast and large-scale production technology bottlenecks through peptide production facilities improvement and independent innovation of peptide research and development,forming a seven utility model patents and two invention patents. Main products applied to the tumor, treatment of diabetes, cardiovascular and cerebrovascular diseases, as well as animal immunity, protein electrophoresis, phosphorylation research and enzyme . The market of products cover the various provinces and cities nationwide, autonomous regions, also exported to Europe, America, Middle East, Hong Kong, Macao and Taiwan and other regions.

Our R & D innovation team consists of a team of industry leading talent. Meanwhile the master of R & D personnel accounted for more than 15% of the total number of employees at the same time. The company also invited domestic and foreign top biomedical scientists as scientific advisor. The company is equipped with first-class precision instruments in peptide synthesis, purification, freeze-drying, quality inspection and analysis .We have introduced LC-MS LC-MS, ultra high pressure liquid chromatography, ultraviolet spectrophotometer and other special equipment from the United States, Japan and other countries. Sincere attitude, comprehensive professional services, powerful hardware and software support promote the company to establish a cooperative relationship with more than 100 domestic and foreign research institutions and pharmaceutical enterprises.

Bankpeptide adheres to the "quality first, service first" business philosophy.With professional R & D team, leading technology, advanced equipment, We commit to provide high quality peptide products and technical services for researchers and large pharmaceutical companies, and strive to build a global peptide leading brand with core competitiveness .

Top suppliers:

Name: Dayang Chem (Hangzhou) Co., Ltd.

Area: China

Price:
¥Inquiry/1kg ¥Inquiry/5g ¥Inquiry/100mg

Contact: Ms Wang

Product Detail: EXENDIN-4 (3-39)


Get all suppliers by the below link:

Exendin-4 (3-39) suppliers

Price from the other suppliers:

2018-02-19 EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

2021-07-26 EXENDIN-4 (3-39)

Get all price from the following link:

Exendin-4 (3-39) price