Nesiritide acetate
Published date: 2018-07-04 16:37:19
|
Name | Nesiritide acetate | CAS# | 114471-18-0 |
|---|---|---|---|---|
| Price | ￥Inquiry/1kg ￥Inquiry/1g ￥Inquiry/1mg | Purity | 98.0% | |
| Stocking Period |
Inquiry | Stock | In Stock |
| Detail
Product Information
Chemical & Physical Properties: CAS Number: 114471-18-0 Name: Nesiritide acetate Molecular Formula: C143H244N50O42S4 Molecular Weight: 3464.04000 Density: 1.529 g/cm3 Boiling Point: N/A Melting Point: N/A Flash Point: N/A |
Supplier/Manufacture
Hangzhou peptidego biotech Co.,Ltd
Chemsrc Level: UnverifiedTel: 0571-87213919
Address: Building 6,Tianhe Hi-Tech park, Binjiang district, Hangzhou, Zhejiang , China
Area: China
Contact: Ellis
Contact Phone #: 15967184799
Email: ellis@peptidego.com
Website: http://www.peptidego.com
Major Market:
Annual Trade Volume:
Foreign Trade % of Sales:
Major partners:
Hangzhou Peptidego Biotech Co.,Ltd , located in Tianhe Hi-Tech park, Binjiang district, Hangzhou. The main researchers are experienced in peptide research and commercial production. We can supply generic peptide API, cosmetic peptide, custom peptide(include: Glycopeptides, Stable isotope labeling,Chelating Peptide , Multiple-Antigen peptide, dye labeled peptides ,PEGylation, Stapled peptides,multiple disulfide bonds etc.)
We are committed to providing high quality peptide products and services for global customer in peptide screening, process development and commercial production.
We are committed to providing high quality peptide products and services for global customer in peptide screening, process development and commercial production.
Top Suppliers:
- Shanghai Nianxing Industrial Co., Ltd
- China
- Product Name: BrainNatriureticPeptide-32human
- Price: Check
- Purity: 98.0%
- Stocking Period: 10 Day
- Contact: Yang
- Email: sales@echemcloud.com
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: BNP-32, human;SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Disulfidebridge:10-26)
- Price: $Inquiry/1g
- Purity: 98.0%
- Stocking Period: Inquiry
- Contact: Jackie Yang
- Email: ymbetter@glbiochem.com
- DC Chemicals Limited
- China
- Product Name: Nesiritide Acetate
- Price: ￥Inquiry/100mg ￥Inquiry/250mg ￥Inquiry/1g
- Purity: 98.0%
- Stocking Period: 10 Day
- Contact: Tony Cao
- Email: sales@dcchemicals.com
Get all suppliers by the below link:
Price: $130/1mg
Price from the other suppliers:
| 2024-07-15 |
BrainNatriureticPeptide-32human
Price: Inquiry |
| 2018-01-09 |
BNP-32, human;SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Disulfidebridge:10-26)
Price: $Inquiry |
| 2024-07-17 |
Nesiritide Acetate
Price: ￥Inquiry |
| 2024-05-30 |
Nesiritide acetate
Price: $Inquiry |
| 2023-11-22 |
Nesiritide acetate
Price: ￥Inquiry |
| 2021-02-06 |
BNP (1-32), human
Price: ￥7689.0 |
Get all price from the following link:
Related product price:
- NESIRITIDE ACETATE price
- chrysanthenyl acetate price
- Glutinol acetate price
- Menthyl acetate price
- isoprenyl acetate price
- Germanicol acetate price
- Cupric acetate monohydrate price
- ethyl acetate, [1-14c] price
- ethyl acetate-2-13C price
- 3-(1-isocyanatocyclopropyl)-1H,4H,5H,6H-cyclopenta[c]pyrazole price
- 2-(1-Amino-2-methylpropan-2-yl)-5-(diethylamino)phenol price
- 1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl 1-(2-fluorophenyl)-5-(propan-2-yl)-1H-1,2,4-triazole-3-carboxylate price
- 3-(3-Bromo-4-fluorophenyl)-3,3-difluoropropan-1-amine price
- tert-butyl N-{3-amino-2-[3,5-dimethyl-1-(propan-2-yl)-1H-pyrazol-4-yl]-2-methylpropyl}carbamate price
- 2-[1-(2-Methanesulfonylphenyl)cyclopropyl]ethan-1-amine price
- 1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl 4-(hexyloxy)-3-methoxybenzoate price
- 1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl 2-(N-methylthiophene-2-amido)benzoate price
- 1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl 2-{[4-(2-ethylphenyl)-4H-1,2,4-triazol-3-yl]sulfanyl}acetate price
- 1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl 3-(morpholine-4-sulfonyl)benzoate price
Nesiritide acetate price is ￥Inquiry/1kg. Find complete details about Nesiritide acetate product information includes price/quote, purity, stocking period etc. from Hangzhou peptidego biotech Co.,Ltd>>Mobile(AMP)
version: Nesiritide acetate Price from
Supplier Brand Hangzhou peptidego biotech Co.,Ltd