Nesiritide acetate

Published date: 2023-11-22 10:13:31
Nesiritide acetate Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Nesiritide acetate CAS# 114471-18-0
Price ￥Inquiry/1g ￥Inquiry/10g ￥Inquiry/100g Purity 99.0%
Stocking
Period		 Inquiry Stock In Stock
 Detail Product Information
Product Name Nesiritide Acetate (BNP-32)
Cas No. 114471-18-0
Molecular Formula C143H244N50O42 S4
Molecular Weight 3464.04
Purity (HPLC) 97.0%min.
Appearance White powder
Single Impurity(HPLC)
1.0%max
Amino Acid Composition
±10% of theoretical
Peptide Content(N%)
≥78.0%
Water Content(Karl Fischer)
≤6.0%
Acetate Content(HPIC)
≤15.0%
MS(ESI)
Consistent
Mass Balance 95.0~105.0%
Supplier/Manufacture

XI'AN YIHUI BIO-TECHNOLOGY CO., LTD

Chemsrc Level: Unverified
Tel: 029-89695240
Address: Room 801, Unit 1, Building 3, Tianciyifu, No.239 Shenzhou Third Road, National Civil Aerospace Base, Xi'an City, Shaanxi Province, China
Area: China
Contact: Doris
Contact Phone #: 0086 17792415937
Email: sales@yihuipharm.com
Website: https://www.yihuipharm.com/
Major Market: United States, Europe, South America, Middle East, Africa, Southeast Asia, West Asia
Annual Trade Volume:
Foreign Trade % of Sales:
Major partners:
Xi'an Yihui Company, established in 2010, is a biotechnology company headquartered in Xi'an, China. The company has gained recognition for its achievements in research, development, production, and sales of pharmaceutical raw materials and fine chemicals.
Top Suppliers:

Get all suppliers by the below link:

Nesiritide acetate suppliers

Price: $130/1mg
Price from the other suppliers:
2024-07-15 BrainNatriureticPeptide-32human
Price: Inquiry
2018-01-09 BNP-32, human;SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Disulfidebridge:10-26)
Price: $Inquiry
2024-07-17 Nesiritide Acetate
Price: ￥Inquiry
2024-05-30 Nesiritide acetate
Price: $Inquiry
2018-07-04 Nesiritide acetate
Price: ￥Inquiry
2021-02-06 BNP (1-32), human
Price: ￥7689.0

Get all price from the following link:

Nesiritide acetateprice

Related product price:
Nesiritide acetate price is ￥Inquiry/1g. Find complete details about Nesiritide acetate product information includes price/quote, purity, stocking period etc. from XI'AN YIHUI BIO-TECHNOLOGY CO., LTD>>Mobile(AMP) version: Nesiritide acetate Price from Supplier Brand XI'AN YIHUI BIO-TECHNOLOGY CO., LTD

Home | MSDS/SDS Database Search | Journals | Product Classification | Biologically Active Compounds | Selling Leads | About Us | Disclaimer

Copyright © 2024 ChemSrc All Rights Reserved