< Property Suppliers>

Nesiritide acetate

Product detail:

Published date: 2024-08-31 16:49:23

CAS number: 114471-18-0

Name: Nesiritide acetate

Price:
¥Inquiry/1kg ¥Inquiry/1g ¥Inquiry/1mg

Purity: 98.0%

Stocking period: Inquiry

Stock: In Stock

Supplier/Manufacture:

Name: Hangzhou peptidego biotech Co.,Ltd

Chemsrc Level: Unverified

Product #: 74

Tel: 0571-87213919

Address: Building 6,Tianhe Hi-Tech park, Binjiang district, Hangzhou, Zhejiang , China

Area: China(Mainland)

Contact: Ellis

Contact Phone #: 15967184799

Email: ellis@peptidego.com

Website: http://www.peptidego.com

Major Market:

Annual Trade Volume:

Foreign Trade % of Salers:

Major partners:

Detail introduction:
Hangzhou Peptidego Biotech Co.,Ltd , located in Tianhe Hi-Tech park, Binjiang district, Hangzhou. The main researchers are experienced in peptide research and commercial production. We can supply generic peptide API, cosmetic peptide, custom peptide(include: Glycopeptides, Stable isotope labeling,Chelating Peptide , Multiple-Antigen peptide, dye labeled peptides ,PEGylation, Stapled peptides,multiple disulfide bonds etc.)
We are committed to providing high quality peptide products and services for global customer in peptide screening, process development and commercial production.

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
¥Inquiry/1kg ¥Inquiry/1g ¥Inquiry/1mg

Contact: Yang

Product Detail: BrainNatriureticPeptide-32human


Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:
¥Inquiry/1kg ¥Inquiry/1g ¥Inquiry/1mg

Contact: Jackie Yang

Product Detail: BNP-32, human;SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Disulfidebridge:10-26)


Name: DC Chemicals Limited

Area: China

Price:
¥Inquiry/1kg ¥Inquiry/1g ¥Inquiry/1mg

Contact: Tony Cao

Product Detail: Nesiritide Acetate


Get all suppliers by the below link:

Nesiritide acetate suppliers

Price from the other suppliers:

2024-07-15 BrainNatriureticPeptide-32human

2018-01-09 BNP-32, human;SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Disulfidebridge:10-26)

2024-07-17 Nesiritide Acetate

2024-05-30 Nesiritide acetate

2023-11-22 Nesiritide acetate

2021-02-06 BNP (1-32), human

Get all price from the following link:

Nesiritide acetate price