Published date: 2024-08-31 16:49:23
CAS number: 114471-18-0
Name: Nesiritide acetate
Price:
¥Inquiry/1kg
¥Inquiry/1g
¥Inquiry/1mg
Purity: 98.0%
Stocking period: Inquiry
Stock: In Stock
Name: Hangzhou peptidego biotech Co.,Ltd
Chemsrc Level: Unverified
Product #: 74
Tel: 0571-87213919
Address: Building 6,Tianhe Hi-Tech park, Binjiang district, Hangzhou, Zhejiang , China
Area: China(Mainland)
Contact: Ellis
Contact Phone #: 15967184799
Email: ellis@peptidego.com
Website: http://www.peptidego.com
Major Market:
Annual Trade Volume:
Foreign Trade % of Salers:
Major partners:
Detail
introduction:
Hangzhou Peptidego Biotech Co.,Ltd , located in Tianhe Hi-Tech park, Binjiang district, Hangzhou. The main researchers are experienced in peptide research and commercial production. We can supply generic peptide API, cosmetic peptide, custom peptide(include: Glycopeptides, Stable isotope labeling,Chelating Peptide , Multiple-Antigen peptide, dye labeled peptides ,PEGylation, Stapled peptides,multiple disulfide bonds etc.)
We are committed to providing high quality peptide products and services for global customer in peptide screening, process development and commercial production.
Name: Shanghai Nianxing Industrial Co., Ltd
Area: China
Price:
¥Inquiry/1kg
¥Inquiry/1g
¥Inquiry/1mg
Contact: Yang
Product Detail: BrainNatriureticPeptide-32human
Get all suppliers by the below link:
2024-07-15 BrainNatriureticPeptide-32human
2018-01-09 BNP-32, human;SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Disulfidebridge:10-26)
2024-05-30 Nesiritide acetate
2023-11-22 Nesiritide acetate
2021-02-06 BNP (1-32), human
Get all price from the following link: