pTH (1-38) (human)
Modify Date: 2025-08-20 13:03:57
pTH (1-38) (human) structure
|
Common Name | pTH (1-38) (human) | ||
|---|---|---|---|---|
| CAS Number | 104218-12-4 | Molecular Weight | N/A | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | N/A | Melting Point | N/A | |
| MSDS | N/A | Flash Point | N/A | |
| Name | pTH (1-38) (human) |
|---|---|
| Synonym | More Synonyms |
| No Any Chemical & Physical Properties |
| SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-VAL-ALA-LEU-GLY-ALA-PRO-LEU-ALA-PRO-ARG: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR |
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.
- Shanghai Nianxing Industrial Co., Ltd
- China
- Product Name: Palmitic acid
- Price: Check
- Purity: 98.0%
- Delivery: 10 Day
- Contact: Yang
- Email: sales@echemcloud.com
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: pTH (1-38) (human)
- Price: $Inquiry/1g
- Purity: 98.0%
- Delivery: Inquiry
- Contact: Jackie Yang
- Email: ymbetter@glbiochem.com
- Nanjing Peptide Biotech Ltd
- China
- Product Name: pTH (1-38) (human)
- Price: ￥Inquiry/10g ￥Inquiry/100g ￥Inquiry/1kg ￥Inquiry/10kg
- Purity: 98.0%
- Delivery: 7 Day
- Contact: jom
- Email: chenglong.fan@njpeptide.com
Get all suppliers and price by the below link: