Corticotropin-Releasing Factor, human, rat
Published date: 2023-11-16 11:17:46
|
Name | Corticotropin-Releasing Factor, human, rat | CAS# | 86784-80-7 |
|---|---|---|---|---|
| Price | ￥Inquiry/1g ￥Inquiry/10g | Purity | 99.0% | |
| Stocking Period |
Inquiry | Stock | In Stock |
| Detail
Product Information
Product Name CRF (human, rat) Acetate Sequence Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 Cas No. 86784-80-7 Molecular Formula C208H344N60O63S2 Molecular Weight 4757.55 Purity (HPLC) 98.0% Appearance White powder Single Impurity(HPLC) 1.0% Amino Acid Composition 10% of theoretical Peptide Content(N%) 80%(by %N) Water Content(Karl Fischer) 6.0% Acetate Content(HPIC) 15.0% MS(ESI) Mass Balance 95.0～105.0% |
- Shanghai Nianxing Industrial Co., Ltd
- China
- Product Name: Corticotropin-Releasing Factor, human, rat
- Price: Check
- Purity: 98.0%
- Stocking Period: 10 Day
- Contact: Yang
- Email: sales@echemcloud.com
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
- Price: $Inquiry/1g
- Purity: 98.0%
- Stocking Period: Inquiry
- Contact: Jackie Yang
- Email: ymbetter@glbiochem.com
- Shanghai Jizhi Biochemical Technology Co., Ltd
- China
- Product Name: Corticotropin-Releasing Factor, human, rat
- Price: ￥Inquiry/1mg ￥2168.0/1mg ￥Inquiry/1mg
- Purity: 95.0%
- Stocking Period: Inquiry
- Contact: Liu jia
- Email: 2130147988@qq.com
- ShangHai DC Chemicals Co.,Ltd
- China
- Product Name: Corticotropin-releasing factor (human)
- Price: ￥Inquiry/1g
- Purity: 98.9%
- Stocking Period: 1 Day
- Contact: Tony Lai
- Email: order@dcchemicals.com
- DC Chemicals Limited
- China
- Product Name: Corticotropin-releasing factor (human)
- Price: $Inquiry/1mg $104.0/1mg $368.0/5mg
- Purity: 98.0%
- Stocking Period: 3 Day
- Contact: Tony Cao
- Email: sales@dcchemicals.com
Get all suppliers by the below link:
Corticotropin-Releasing Factor, human, rat suppliers
Price: $60/250ug