Cecropin B

Published date: 2022-11-29 15:44:27

Cecropin B Structure
Share to Facebook Share to Twitter Share to Linkedin
Name Cecropin B CAS# 80451-05-4
Price ¥Inquiry/1g Purity 98.9%
Stocking
Period
1 Day Stock In Stock
 Detail Product Information
Cecropin B is an antimicrobial peptide with MICs(0.5 to 16 ug/ml) against Gramnegative strains.

Supplier/Manufacture

ShangHai DC Chemicals Co.,Ltd verified supplier

Chemsrc Level: Verified
Product #: 14107
Tel: 58447131
Address: Pudong new area Jin Yu road 100#
Area: China
Contact: Tony Lai
Contact Phone #: 13564518121
Email: order@dcchemicals.com
Website: http://www.biomedgen.cn
Foreign Trade % of Sales: 20%
Major partners:
D&C Chemicals provides a wide range of research chemicals and biochemicals including novel life-science reagents, reference compounds, APIs and Natural compounds for laboratory and scientific use.



D&C Chem has established a global network of thousands of customers from many research centers and Reagent companies in the USA, Europe and Japan.

We are the the official vendor of more than 500 universities and institutes including: Harvard University,Yale University,NIH/NCI, City of Hope ORG, PARTNERS ORG,John Hopkins University,Universit tsklinikum,Oxford University,Newcastle University,UNC,UCSF and many other universities and institutes. Our bioactive compounds received good feedback from our customers.





Our credo is committed to the adoption of different products, reliable quality, competitive prices and quality service to create value for customers.



Terms & Conditions





In the following Terms & Conditions DC shall mean DC Chemicals Limited. The Terms & Conditions defined below shall apply to DC branded products and services and to products distributed by DC on behalf of other suppliers.

The contents of this website, such as text, graphics, images information and other material ('Content'), are protected by copyright and other intellectual property laws, and all intellectual property rights in them belong to DC, or are licensed to it.

All DC products are manufactured under non- cGMP conditions and are for labatory research use only, not for any human or veterinary use. They should be used only by technically-qualified individuals or under their direct supervision.

All text, graphics, button icons, images, (collectively, known as 'Content'), belongs exclusively to DC Chemicals Ltd. The collection, arrangement, and assemblyof all Content on this Site (the "Compilation") belongs exclusively to DC Chemicals Ltd. The Content and the Compilation are all protected by U.S. and international copyright laws. DC authorises you to use the Content on this website solely for the purpose of purchasing products from us or otherwise promoting our products but you are not permitted to use the Content in competition with DC or any DC products.

DCCHEMICALS.COM and DC Chemicals are registered trademarks. The use of any of our trademarks or service marks without our express written consent is strictly prohibited. You may not use our trademarks or service marks in connection with any product or service in any way that is likely to cause confusion. You may not use our trademarks or service marks in any manner that disparages or discredits us. You may not use any of our trademarks or service marks in meta tags without prior explicit consent.

All users of the DC Chemicals website are deemed to have accepted these Terms and Condition in their entirety.

Nothing in these terms is intended to provide any rights to third parties to enforce any term.
Top Suppliers:





Get all suppliers by the below link:

Cecropin B suppliers


Price: $108/500ug
Price from the other suppliers:
2024-07-15 CecropinB
Price: Inquiry
2018-02-10 KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Price: $Inquiry
2020-01-06 Cecropin B
Price: $104.0
2021-07-26 CECROPIN B
Price: $Inquiry

Get all price from the following link:

Cecropin Bprice