[Des-His1,Glu9]-Glucagon amide

Published date: 2020-12-18 22:54:27
[Des-His1,Glu9]-Glucagon amide Structure
Share to Facebook Share to Twitter Share to Linkedin
Name (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) CAS# 110084-95-2
Price $Inquiry/250mg $Inquiry/100mg $Inquiry/1g Purity 98.0%
Stocking
Period		 3 Day Stock 3
Product Webpage: https://www.dcchemicals.com/product_show-Des-His1-Glu9-Glucagon_amide.html
 Detail Product Information
[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes.
Supplier/Manufacture

DC Chemicals Limited verified supplier

Chemsrc Level: Verified
Product #: 34963
Tel: 58447131
Address: Jinyu Rd100, pudong
Area: China
Contact: Tony Cao
Contact Phone #: 13564518121
Email: sales@dcchemicals.com
Website: http://www.dcchemicals.com
Major Market:
Foreign Trade % of Sales:
Major partners:
D&C Chemicals provides a wide range of research chemicals and biochemicals including novel life-science reagents, reference compounds, APIs and Natural compounds for laboratory and scientific use.



D&C Chem has established a global network of thousands of customers from many research centers and Reagent companies in the USA, Europe and Japan.

We are the the official vendor of more than 500 universities and institutes including: Harvard University,Yale University,NIH/NCI, City of Hope ORG, PARTNERS ORG,John Hopkins University,Universit tsklinikum,Oxford University,Newcastle University,UNC,UCSF and many other universities and institutes. Our bioactive compounds received good feedback from our customers.





Our credo is committed to the adoption of different products, reliable quality, competitive prices and quality service to create value for customers.
Top Suppliers:

Get all suppliers by the below link:

(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) suppliers

Price from the other suppliers:
2024-07-15 des-His1-[Glu9]-Glucagon (1-29) amide
Price: Inquiry
2018-01-08 SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2
Price: $Inquiry
2020-04-03 (Des-His1,Glu9)-Glucagon (1-29) amide
Price: ￥Inquiry
2021-07-26 H-SER-GLN-GLY-THR-PHE-THR-SER-GLU-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-NH2
Price: $Inquiry
2024-05-30 (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)
Price: $Inquiry
2021-02-06 des-His1-[Glu9]-Glucagon (1-29) amide
Price: ￥6389.0

Get all price from the following link:

(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)price

Related product price:
[Des-His1,Glu9]-Glucagon amide price is $Inquiry/250mg. Find complete details about [Des-His1,Glu9]-Glucagon amide product information includes price/quote, purity, stocking period etc. from DC Chemicals Limited>>Mobile(AMP) version: [Des-His1,Glu9]-Glucagon amide Price from Supplier Brand DC Chemicals Limited

Home | MSDS/SDS Database Search | Journals | Product Classification | Biologically Active Compounds | Selling Leads | About Us | Disclaimer

Copyright © 2024 ChemSrc All Rights Reserved