Vivek Kumar Morya, Sangeeta Yadav, Eun-Ki Kim, Dinesh Yadav
Index: Appl. Biochem. Biotechnol. 166(1) , 243-57, (2012)
Full Text: HTML
A total of 49 protein sequences of alkaline proteases retrieved from GenBank representing different species of Aspergillus have been characterized for various physiochemical properties, homology search, multiple sequence alignment, motif, and super family search and phylogenetic tree construction. The sequence level homology was obtained among different groups of alkaline protease enzymes, viz alkaline serine protease, oryzin, calpain-like protease, serine protease, subtilisin-like alkaline proteases. Multiple sequence alignment of alkaline protease protein sequence of different Aspergillus species revealed a stretch of conserved region for amino acid residues from 69 to 110 and 130-204. The phylogenetic tree constructed indicated several Aspergillus species-specific clusters for alkaline proteases namely Aspergillus fumigatus, Aspergillus niger, Aspergillus oryzae, Aspergillus clavatus. The distributions of ten commonly observed motifs were analyzed among these proteases. Motif 1 with a signature amino acid sequence of 50 amino acids, i.e., ASFSNYGKVVDIFAPGQDILSCWIGSTTATNTISGTSMATPHIVGLSCYL, was uniformly observed in proteases protein sequences indicating its involvement with the structure and enzymatic function. Motif analysis of acidic proteases of Aspergillus and bacterial alkaline proteases has revealed different signature amino acid sequences. The superfamily search for these proteases revealed the presence of subtilases, serine-carboxyl proteinase, calpain large subunit, and thermolysin-like superfamilies with 45 representing the subtilases superfamily.
Structure | Name/CAS No. | Molecular Formula | Articles |
---|---|---|---|
![]() |
Subtilisin (Compound proteinase)
CAS:9014-01-1 |
C11H9N3O2.Na |
Abnormalities in Expression of Structural, Barrier and Diffe...
2015-08-01 [J. Urol. 194 , 571-7, (2015)] |
Defects in calcium homeostasis and mitochondria can be rever...
2015-01-01 [Autophagy 11(2) , 385-402, (2015)] |
Cardioprotective effects of early and late aerobic exercise ...
2015-11-01 [Basic Res. Cardiol. 110 , 57, (2015)] |
Structural insights into the unique inhibitory mechanism of ...
2015-01-01 [Sci. Rep. 5 , 11863, (2015)] |
Cytogenetic significance of chromosome 17 aberrations and P5...
2015-01-01 [Diagn. Pathol. 10 , 2, (2015)] |
Home | MSDS/SDS Database Search | Journals | Product Classification | Biologically Active Compounds | Selling Leads | About Us | Disclaimer
Copyright © 2024 ChemSrc All Rights Reserved