TIP-39 trifluoroacetate salt
Modify Date: 2024-01-10 15:42:45
TIP-39 trifluoroacetate salt structure
|
Common Name | TIP-39 trifluoroacetate salt | ||
|---|---|---|---|---|
| CAS Number | 277302-47-3 | Molecular Weight | N/A | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | C202H325N61O54S | Melting Point | N/A | |
| MSDS | N/A | Flash Point | N/A | |
Use of TIP-39 trifluoroacetate saltTIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1]. |
| Name | TIP 39 |
|---|---|
| Synonym | More Synonyms |
| Description | TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1]. |
|---|---|
| Related Catalog | |
| References |
| Molecular Formula | C202H325N61O54S |
|---|
| SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
- GL Biochem (Shanghai) Ltd.
- China
- Product Name: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
- Price: $Inquiry/1kg
- Purity: 98.0%
- Stocking Period: Inquiry
- Contact: Jackie Yang
- DC Chemicals Limited
- China
- Product Name: TIP 39, Tuberoinfundibular Neuropeptide
- Price: ￥Inquiry/1g
- Purity: 98.9%
- Stocking Period: 1 Day
- Contact: Tony Cao
- Taiwan Oyi peptide Co. Ltd
- China
- Product Name: TIP-39 trifluoroacetate salt
- Price: $Inquiry/1mg $Inquiry/100kg
- Purity: 98.0%
- Stocking Period: 1 Day
- Contact: Vinnie
Get all suppliers and price by the below link: