Top Suppliers:I want be here


77367-63-6

77367-63-6 structure
77367-63-6 structure
  • Name: beta-Endorphin
  • Chemical Name: beta-Endorphin
  • CAS Number: 77367-63-6
  • Molecular Formula: C157H254N42O44S
  • Molecular Weight: 3466.02000
  • Catalog: Biochemical Peptide
  • Create Date: 2018-02-20 08:00:00
  • Modify Date: 2024-01-03 23:01:44

Name beta-Endorphin
Synonyms MFCD00133129
YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ
Molecular Formula C157H254N42O44S
Molecular Weight 3466.02000
Exact Mass 3463.86000
PSA 1442.65000
LogP 4.20720
Storage condition −20°C
Personal Protective Equipment Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADR NONH for all modes of transport
WGK Germany 3