GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt structure
|
Common Name | GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt | ||
---|---|---|---|---|
CAS Number | 99658-04-5 | Molecular Weight | 533.688 | |
Density | 1.3±0.1 g/cm3 | Boiling Point | N/A | |
Molecular Formula | C28H35N7O2S | Melting Point | N/A | |
MSDS | N/A | Flash Point | N/A |
Use of GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate saltGLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells[1]. |
Name | Glucagon-like Peptide 1 Amide (Human) |
---|---|
Synonym | More Synonyms |
Description | GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells[1]. |
---|---|
Related Catalog | |
References |
Density | 1.3±0.1 g/cm3 |
---|---|
Molecular Formula | C28H35N7O2S |
Molecular Weight | 533.688 |
Exact Mass | 533.257263 |
LogP | 3.10 |
Index of Refraction | 1.666 |
Storage condition | −20°C |
WGK Germany | 3 |
---|
Methanesulfonamide, N-methyl-N-[[2-[[[2-[[4-(1-methyl-4-piperidinyl)phenyl]amino][1,2,4]triazolo[1,5-a]pyridin-8-yl]amino]methyl]phenyl]methyl]- |
N-Methyl-N-(2-{[(2-{[4-(1-methyl-4-piperidinyl)phenyl]amino}[1,2,4]triazolo[1,5-a]pyridin-8-yl)amino]methyl}benzyl)methanesulfonamide |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |