Nogo-66(1-40)
Modify Date: 2025-11-26 12:39:20
Nogo-66(1-40) structure
|
Common Name | Nogo-66(1-40) | ||
|---|---|---|---|---|
| CAS Number | 475221-20-6 | Molecular Weight | 4625.11000 | |
| Density | N/A | Boiling Point | N/A | |
| Molecular Formula | C118H177N35O29S | Melting Point | N/A | |
| MSDS | N/A | Flash Point | N/A | |
Use of Nogo-66(1-40)NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition[1]. |
| Name | Nogo-66 (1-40) |
|---|---|
| Synonym | More Synonyms |
| Description | NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition[1]. |
|---|---|
| Related Catalog | |
| In Vivo | NEP(1-40) (89 μg/kg, ip, 15 min and 19 h post-injury) administration further shifts distributions of microglia away from an injury-induced activated morphology towards greater proportions of rod and macrophage-like morphologies[1]. Animal Model: 74 male Sprague-Dawley rats (328-377 g)[1]. Dosage: 89 μg/kg (97.5% PBS and 2.5% DMSO). Administration: IP, 15 min and 19 h post-injury. Result: Reduced NgR function immediately post-injury. Increased number of amoeboid microglia/macrophages at 2 days post-injury |
| References |
| Molecular Formula | C118H177N35O29S |
|---|---|
| Molecular Weight | 4625.11000 |
| Exact Mass | 4622.38000 |
| PSA | 1986.84000 |
| LogP | 3.52320 |
| m.w. 4625.11 c206h324n56o65 |
| nogo extracellular peptide,1-40 |
| arg-ile-tyr-lys-gly-val-ile-gln-ala-ile-gln-lys-ser-asp-glu-gly-his-pro-phe-arg-ala-tyr-leu-glu-ser-glu-val-ala-ile-ser-glu-glu-leu-val-gln-lys-tyr-ser-asn-ser-nh2 |
| nep1-40 |
| ac-riykgviqaiqksdeghpfraylesevaiseelvqkysns-nh2 |
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.
- Shanghai Nianxing Industrial Co., Ltd
- China
- Product Name: Nogo-66（1-40）
- Price: Check
- Purity: 98.0%
- Delivery: 10 Day
- Contact: Yang
- Email: sales@echemcloud.com
- DC Chemicals Limited
- China
- Product Name: NEP(1-40)
- Price: $Inquiry/250mg $Inquiry/100mg $Inquiry/1g
- Purity: 98.0%
- Delivery: 3 Day
- Contact: Tony Cao
- Email: sales@dcchemicals.com
- Nanjing Peptide Biotech Ltd
- China
- Product Name: Nogo-66 (1-40)
- Price: ￥Inquiry/10g ￥Inquiry/100g ￥Inquiry/1kg ￥Inquiry/10kg
- Purity: 98.0%
- Delivery: 7 Day
- Contact: jom
- Email: chenglong.fan@njpeptide.com
Get all suppliers and price by the below link: