TIP-39 trifluoroacetate salt

Modify Date: 2025-08-20 20:51:01

TIP-39 trifluoroacetate salt structure	Common Name	TIP-39 trifluoroacetate salt
	CAS Number	277302-47-3	Molecular Weight	N/A
	Density	N/A	Boiling Point	N/A
	Molecular Formula	C₂₀₂H₃₂₅N₆₁O₅₄S	Melting Point	N/A
	MSDS	N/A	Flash Point	N/A

Use of TIP-39 trifluoroacetate salt

TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1].

Name	TIP 39
Synonym	More Synonyms

Description	TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1].
Related Catalog	Signaling Pathways >> GPCR/G Protein >> Adenylate Cyclase Research Areas >> Neurological Disease
References	[1]. Della Penna K, et al. Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor. Neuropharmacology. 2003 Jan;44(1):141-53.

Molecular Formula	C₂₀₂H₃₂₅N₆₁O₅₄S

SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.

Shanghai Nianxing Industrial Co., Ltd
China
Product Name: TIP 39, Tuberoinfundibular Neuropeptide
Price: Check
Purity: 99.0%
Delivery: 10 Day
Contact: Yang
Email: sales@echemcloud.com

GL Biochem (Shanghai) Ltd.
China
Product Name: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Price: $Inquiry/1kg
Purity: 98.0%
Delivery: Inquiry
Contact: Jackie Yang
Email: ymbetter@glbiochem.com

DC Chemicals Limited
China
Product Name: TIP 39, Tuberoinfundibular Neuropeptide
Price: ￥Inquiry/1g
Purity: 98.9%
Delivery: 1 Day
Contact: Tony Cao
Email: sales@dcchemicals.com

Get all suppliers and price by the below link:

TIP-39 trifluoroacetate salt suppliers

TIP-39 trifluoroacetate salt price

TIP-39 trifluoroacetate salt

Use of TIP-39 trifluoroacetate salt

Names

TIP-39 trifluoroacetate salt Biological Activity

Chemical & Physical Properties

Synonyms

The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.