(Gln11)-Amyloid β-Protein (1-28) trifluoroacetate salt

Modify Date: 2025-09-20 22:15:48

(Gln11)-Amyloid β-Protein (1-28) trifluoroacetate salt Structure
(Gln11)-Amyloid β-Protein (1-28) trifluoroacetate salt structure
Common Name (Gln11)-Amyloid β-Protein (1-28) trifluoroacetate salt
CAS Number 106686-61-7 Molecular Weight 3262.46000
Density N/A Boiling Point N/A
Molecular Formula C145H209N41O46 Melting Point N/A
MSDS N/A Flash Point N/A

 Names

Name Amyloid β-Protein Fragment 1-28
Synonym More Synonyms

 Chemical & Physical Properties

Molecular Formula C145H209N41O46
Molecular Weight 3262.46000
Exact Mass 3260.53000
PSA 1419.67000
LogP 1.29040

 Synonyms

Amyloid |A-Protein Fragment 1-28
DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
(Gln11)-Amyloid β-Protein (1-28)
[Gln11]-beta-Amyloid (1-40)
The content on this webpage is sourced from various professional data sources. If you have any questions or concerns regarding the content, please feel free to contact service1@chemsrc.com.