198328-30-2

198328-30-2 structure

Name: Amylin (1-13) (human)
Chemical Name: Amylin (1-13), human
CAS Number: 198328-30-2
Molecular Formula: C₅₄H₉₅N₁₉O₁₉S₂
Molecular Weight: 1378.58
Catalog: Research Areas Metabolic Disease
Create Date: 2016-11-24 14:45:28
Modify Date: 2024-01-13 14:00:08
Amylin (1-13) (human) is a fragment and a residues within amyloid cores of Amylin (human IAPP). Amylin is a glucose-regulating hormone, deposits as amyloid fibrils in condition of type II diabetes (T2D). Amylin (1-13) (human) has no effect on firbl formation, as it cannot form fibrils by itself[1].

Name	Amylin (1-13), human
Synonyms	H-LYS-CYS-ASN-THR-ALA-THR-CYS-ALA-THR-GLN-ARG-LEU-ALA-OH Islet AMyloid Polypeptide (1-13) (huMan),DAP (1-13) (huMan),InsulinoMa AMyloid Peptide (1-13) (huMan),Diabetes-Associated Peptide (1-13) (huMan) LYS-CYS-ASN-THR-ALA-THR-CYS-ALA-THR-GLN-ARG-LEU-ALA AMYLIN (1-13) (HUMAN) H-LYS-CYS-ASN-THR-ALA-THR-CYS-ALA-THR-GLN-ARG-LEU-ALA-OH (DISULFIDE BRIDGE: 2-7) AMylin (1-13) (huMan) Islet AMyloid Polypeptide (1-13) (huMan),DAP (1-13) (huMan),InsulinoMa AMyloid Peptide (1-13) (huMan),Diabetes-Associated Peptide (1-13) (huMan) H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-OH,(Disulfide bond) KCNTATCATQRLA (DISULFIDE BRIDGE: 2-7) Biotinyl-Neurokinin b,Biotinyl-NeuroMedin K,Biotinyl-NKB ALA-THR-GLN-ARG-LEU-ALA-ASN-PHE-LEU-VAL-ARG-SER-SER-ASN-ASN-LEU-GLY-PRO-VAL-LEU-PRO-PRO-THR-ASN-VAL-GLY-SER-ASN-THR-TYR-NH2: ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 LYS-CYS-ASN-THR-ALA-THR-CYS-ALA-THR-GLN-ARG-LEU-ALA (DISULFIDE BRIDGE:CYS2-CYS7) KCNTATCATQRLA(Disulfidebridge:2-7)

Description	Amylin (1-13) (human) is a fragment and a residues within amyloid cores of Amylin (human IAPP). Amylin is a glucose-regulating hormone, deposits as amyloid fibrils in condition of type II diabetes (T2D). Amylin (1-13) (human) has no effect on firbl formation, as it cannot form fibrils by itself[1].
Related Catalog	Signaling Pathways >> Others >> Others Research Areas >> Metabolic Disease
References	[1]. Cao Q, et al. Cryo-EM structure and inhibitor design of human IAPP (amylin) fibrils. Nat Struct Mol Biol. 2020 Jul;27(7):653-659.