Published date: 2025-09-13 19:11:29
CAS number: 11063-17-5
Name: Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
Price:
Purity: 99.0%
Stocking period: 10 Day
Stock: In Stock
Name: Shanghai ChemSrc Trading Co., Ltd. Recommended
Chemsrc Level: Verified
Product #: 396716
Tel: 53555033
Address: Block b, Saint Noah Building, No. 1759, Jinshajiang Road, Putuo District, Shanghai
Area: China(Mainland)
Contact: Xu Qianming
Contact Phone #: 13311869306
Email: xuqm@chemsrc.com
Website: http://www.chemsrc.com
Major Market:
Annual Trade Volume:
Foreign Trade % of Salers:
Major partners:
Detail
introduction:
Huayuan Network was officially founded in 2015 as a professional community e-commerce platform dedicated to serving the global fine chemical and biopharmaceutical R&D sectors.
With products directly supplied by strictly selected premium brand merchants, the platform takes genuine goods at favorable prices as its core advantage. Combined with a concise and user-friendly mall interface, it provides R&D professionals with one-stop procurement solutions and ensures an efficient and convenient service experience throughout the entire process.
Name: Shanghai Nianxing Industrial Co., Ltd
Area: China
Price:
Contact: Yang
Product Detail: Gastric Inhibitory Peptide, porcine
Get all suppliers by the below link:
Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt suppliers
2024-07-15 Gastric Inhibitory Peptide, porcine
2018-01-08 YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
2024-05-30 Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
Get all price from the following link:
Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt price