< Property Suppliers>

Gastric Inhibitory Peptide, porcine

Product detail:

Published date: 2025-09-13 19:11:29

CAS number: 11063-17-5

Name: Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt

Price:

Purity: 99.0%

Stocking period: 10 Day

Stock: In Stock

Supplier/Manufacture:

Name: Shanghai ChemSrc Trading Co., Ltd. Recommended

Chemsrc Level: Verified

Product #: 396716

Tel: 53555033

Address: Block b, Saint Noah Building, No. 1759, Jinshajiang Road, Putuo District, Shanghai

Area: China(Mainland)

Contact: Xu Qianming

Contact Phone #: 13311869306

Email: xuqm@chemsrc.com

Website: http://www.chemsrc.com

Major Market:

Annual Trade Volume:

Foreign Trade % of Salers:

Major partners:

Detail introduction:
Huayuan Network was officially founded in 2015 as a professional community e-commerce platform dedicated to serving the global fine chemical and biopharmaceutical R&D sectors.
With products directly supplied by strictly selected premium brand merchants, the platform takes genuine goods at favorable prices as its core advantage. Combined with a concise and user-friendly mall interface, it provides R&D professionals with one-stop procurement solutions and ensures an efficient and convenient service experience throughout the entire process.

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:

Contact: Yang

Product Detail: Gastric Inhibitory Peptide, porcine


Get all suppliers by the below link:

Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt suppliers

Price from the other suppliers:

2024-07-15 Gastric Inhibitory Peptide, porcine

2018-01-08 YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

2024-05-30 Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt

Get all price from the following link:

Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt price