< Property Suppliers>

α-Endorphin

Product detail:

Published date: 2025-08-27 18:10:34

CAS number: 59004-96-5

Name: α-Endorphin

Price:
¥770.0/5mg ¥1050.0/10mg ¥1260.0/50mg ¥2380.0/100mg

Purity: 98.0%

Stocking period: Inquiry

Stock: 需询单

Supplier/Manufacture:

Name: Fuzhou Feijing Biological Technology Co., LTD

Chemsrc Level: Unverified

Product #: 810

Tel: 0591-22822350

Address: 7F4, Guanpeng Park, No. 28, Xinghu Road, Nanyu Town

Area: China(Mainland)

Contact: Xiao Fei

Contact Phone #: 18059081430

Email: 2070812664@qq.com

Website: http://www.phygene.com

Major Market:

Annual Trade Volume:

Foreign Trade % of Salers:

Major partners:

Detail introduction:
Phygene is an integrated provider of life science research services and manufacturing, with products and services covering all key scientific research institutions. At present, it has 2500 square meters of research and production base, and is equipped with 100,000 aseptic working areas. It is a national high-tech enterprise and a science and technology small and medium-sized enterprise in Fujian Province. Since its establishment in 2015, it has focused on the development of efficient detection kits, polypeptide reagents, standard solutions, ready-to-use reagents and cost-effective experimental consumables, and its products have been widely involved in the scientific research fields of life science, agricultural biotechnology, pharmaceutical and industry, innovative medical treatment, petrochemical industry, and water quality testing. Our mission is to help our customers accelerate research in science, turn theoretical opportunities into productivity, and make research easier.

The company has passed ISO9001 quality management system certification, and has maintained long-term cooperative relations with many domestic and foreign universities and research institutions. The products involved are widely used by well-known universities and research institutes such as Chinese Academy of Sciences, Tsinghua University, Peking University, Fudan University, Zhejiang University, Lanzhou University, Nanjing University, Southeast University, Xiamen University, etc. Many research papers using Phygene products have been published, including publication in international high-level academic journals such as Cell, Nature, and Science.

Phygene's product line covers a variety of reagents and kits in molecular biology, cell biology, immunology, proteomics, peptide synthesis, biomedicine, standard titrations, ready-to-use reagents and other fields.

Top suppliers:

Name: Shanghai Nianxing Industrial Co., Ltd

Area: China

Price:
¥770.0/5mg ¥1050.0/10mg ¥1260.0/50mg ¥2380.0/100mg

Contact: Yang

Product Detail: α-Endorphin


Name: GL Biochem (Shanghai) Ltd.

Area: China

Price:
¥770.0/5mg ¥1050.0/10mg ¥1260.0/50mg ¥2380.0/100mg

Contact: Jackie Yang

Product Detail: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE


Name: Shanghai Jizhi Biochemical Technology Co., Ltd

Area: China

Price:
¥770.0/5mg ¥1050.0/10mg ¥1260.0/50mg ¥2380.0/100mg

Contact: Liu jia

Product Detail: α-Endorphin


Name: Nanjing Peptide Biotech Ltd

Area: China

Price:
¥770.0/5mg ¥1050.0/10mg ¥1260.0/50mg ¥2380.0/100mg

Contact: jom

Product Detail: β-Endorphin,human


Get all suppliers by the below link:

α-Endorphin suppliers

Price from the other suppliers:

2024-07-15 α-Endorphin

2018-02-15 YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

2019-03-05 α-Endorphin

2020-04-03 β-Endorphin,human

2024-05-30 α-Endorphin

2021-02-06 alpha-Endorphin

Get all price from the following link:

α-Endorphin price