CART (55-102) (human) trifluoroacetate salt

Modify Date: 2024-01-02 10:36:47

CART (55-102) (human) trifluoroacetate salt structure	Common Name	CART (55-102) (human) trifluoroacetate salt
	CAS Number	214050-22-3	Molecular Weight	N/A
	Density	N/A	Boiling Point	N/A
	Molecular Formula	C₂₂₅H₃₆₅N₆₅O₆₅S₇	Melting Point	N/A
	MSDS	N/A	Flash Point	N/A

Use of CART (55-102) (human) trifluoroacetate salt

CART(55-102)(human) is an endogenous satiety factor with potent appetite-suppressing activity. CART(55-102)(human) is closely associated with leptin and neuropeptide Y[1][2].

Name	CART (55-102) (huMan)
Synonym	More Synonyms

Description	CART(55-102)(human) is an endogenous satiety factor with potent appetite-suppressing activity. CART(55-102)(human) is closely associated with leptin and neuropeptide Y[1][2].
Related Catalog	Signaling Pathways >> Others >> Others Research Areas >> Neurological Disease
References	[1]. K Matsumura, et al. Central Human Cocaine- And Amphetamine-Regulated Transcript Peptide 55-102 Increases Arterial Pressure in Conscious Rabbits. Hypertension. 2001 Nov;38(5):1096-100. [2]. H Volkoff, et al. Effects of CART Peptides on Food Consumption, Feeding and Associated Behaviors in the Goldfish, Carassius Auratus: Actions on Neuropeptide Y- And Orexin A-induced Feeding. Brain Res. 2000 Dec 22;887(1):125-33.

Description

CART(55-102)(human) is an endogenous satiety factor with potent appetite-suppressing activity. CART(55-102)(human) is closely associated with leptin and neuropeptide Y[1][2].

Related Catalog

Signaling Pathways >> Others >> Others

Research Areas >> Neurological Disease

References

[1]. K Matsumura, et al. Central Human Cocaine- And Amphetamine-Regulated Transcript Peptide 55-102 Increases Arterial Pressure in Conscious Rabbits. Hypertension. 2001 Nov;38(5):1096-100.

[2]. H Volkoff, et al. Effects of CART Peptides on Food Consumption, Feeding and Associated Behaviors in the Goldfish, Carassius Auratus: Actions on Neuropeptide Y- And Orexin A-induced Feeding. Brain Res. 2000 Dec 22;887(1):125-33.

Molecular Formula	C₂₂₅H₃₆₅N₆₅O₆₅S₇

VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL(Disulfidebridge:74-94,68-86,and88-101)

H-Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH

GL Biochem (Shanghai) Ltd.
China
Product Name: VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Price: $Inquiry/1g
Purity: 98.0%
Stocking Period: Inquiry
Contact: Jackie Yang

DC Chemicals Limited
China
Product Name: CART(55-102)(human) TFA
Price: $Inquiry/250mg $Inquiry/100mg $Inquiry/1g
Purity: 98.0%
Stocking Period: 3 Day
Contact: Tony Cao

Taiwan Oyi peptide Co. Ltd
China
Product Name: CART (55-102) (human) trifluoroacetate salt
Price: $Inquiry/1mg $Inquiry/100kg
Purity: 98.0%
Stocking Period: 1 Day
Contact: Vinnie

Get all suppliers and price by the below link:

CART (55-102) (human) trifluoroacetate salt suppliers

CART (55-102) (human) trifluoroacetate salt price

CART (55-102) (human) trifluoroacetate salt

Use of CART (55-102) (human) trifluoroacetate salt

Names

Biological Activity

Chemical & Physical Properties

Synonyms